6jo6

Structure of the green algal photosystem I supercomplex with light-harvesting complex I

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

Chlamydomonas reinhardtii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

Chlamydomonas reinhardtii

UniProt P09144

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–755； UniProt 1–735

Photosystem I iron-sulfur center

Chlamydomonas reinhardtii

UniProt Q00914

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II, chloroplastic

Chlamydomonas reinhardtii

UniProt Q39615

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–161； UniProt 36–196

Photosystem I reaction center subunit IV, chloroplastic

Chlamydomonas reinhardtii

UniProt P12352

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–73； UniProt 25–97

Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic

Chlamydomonas reinhardtii

UniProt P12356

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–165； UniProt 63–227

Photosystem I reaction center subunit V, chloroplastic

Chlamydomonas reinhardtii

UniProt P14224

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAG_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–94； UniProt 31–124

Photosystem I reaction center subunit VIII

Chlamydomonas reinhardtii

UniProt A8IFG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IFG7_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–106； UniProt 1–106

Photosystem I reaction center subunit IX

Chlamydomonas reinhardtii

UniProt P59777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–41； UniProt 1–41

Photosystem I reaction center subunit psaK, chloroplastic

Chlamydomonas reinhardtii

UniProt P14225

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–87； UniProt 27–113

Photosystem I reaction center subunit XI

Chlamydomonas reinhardtii

UniProt A8IL32

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IL32_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–156； UniProt 41–196

Chlorophyll a-b binding protein, chloroplastic

Chlamydomonas reinhardtii

UniProt Q7DM26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7DM26_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 1； PDBConstruct 1–194； UniProt 31–224 Author chain Z； PDBConstruct 1–194； UniProt 31–224

Chlorophyll a-b binding protein, chloroplastic

Chlamydomonas reinhardtii

UniProt A8JF10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JF10_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 3； PDBConstruct 1–268； UniProt 31–298

Chlorophyll a-b binding protein, chloroplastic

Chlamydomonas reinhardtii

UniProt Q84Y02

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84Y02_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 7； PDBConstruct 1–215； UniProt 27–241

Chlorophyll a-b binding protein, chloroplastic

Chlamydomonas reinhardtii

UniProt Q75VY7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY7_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 8； PDBConstruct 1–217； UniProt 27–243

Chlorophyll a-b binding protein, chloroplastic

Chlamydomonas reinhardtii

UniProt Q75VZ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VZ0_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 4； PDBConstruct 1–236； UniProt 29–264

Chlorophyll a-b binding protein, chloroplastic

Chlamydomonas reinhardtii

UniProt Q75VY8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY8_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 5； PDBConstruct 1–229； UniProt 29–257

Chlorophyll a-b binding protein, chloroplastic

Chlamydomonas reinhardtii

UniProt Q75VY6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit XI × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 197 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BETA-CAROTENE × 32 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLOROPHYLL B × 18 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY6_CHLRE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 6； PDBConstruct 1–232； UniProt 26–257

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6jo6
Deposition date deposition_date	2019-03-20
Structure title title	Structure of the green algal photosystem I supercomplex with light-harvesting complex I
Keywords keywords	photosystem membrane protein, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6jo6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6jo6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6jo6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.72 Å
Rg (electron density)	59.40 Å
Total Rg	59.47 Å
Atom count	45099
Residues	3899
Excluded volume	846410 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6jo6__assembly_1__model_1`	nonadecameric （19）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (28)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83239.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	45099

MTISTPEREAKKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	84947.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATHHHHHHHHHHHHHHHHHHHHKLFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVTDPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRFG

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8869.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSY

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	17732.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

EAEAAPAAAKKAAEKPAWTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMMSPAEI

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	8135.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

EEVKAAPKKEVGPKRGSLVKILRPESYWFNQVGKVVSVDQSGVRYPVVVRFENQNYAGVTTNNYALDEVVAAK

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17957.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTKARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGYIGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQRGTLLEKEENITVSPR

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	9828.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

ALDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQGAN

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	10586.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MALRAVSAKSAVRPTVARASVKPVAALKPAQKMALAGAASVALLAASSSSAEASQVIATVASAAQGYPFVPPSWAPSVFVPLTGLVLPAIAMATLFVYIEKEAPSS

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4750.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MKDFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVFSF

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	8431.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

DGFIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVISNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	16120.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

QVISPVNGDPFVGMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVEIGLAHGFLLAGPFIKLGPLRNVPETAEIAGSLSAAGLVLILALCLSIYGSAQFQSTPSIGVKTLSGRSVARDPLFSADGWSEFAAGFLVGGEAGVAWAYVCTQILPYYS

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 12 Entity 12 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	20368.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,Z

KAGNWLPGSDAPAWLPDDLPGNYGFDPLSLGKEPASLKRFTESEVIHGRWAMLGVAGSLAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVVYPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLANPWGANFATNGISVPFF

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 13 Entity 13 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	29435.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

EEKSIAKVDRSKDQLYVGASQSSLAYLDGSLPGDFGFDPLGLLDPVNSGGFIEPKWLQYSEVIHARWAMLGAAGCIAPEVLGAAGLIPDATNIKWFESGVIPPAGSYNGYWADPYTIFFVEIVAMQFAELRRLQDFRYPGSMGQQYFLGLEAIFKGSGDAAYPGGPFFNLFNLGKTEAAMKELKLKEIKNGRLAMLAMLGYGAQAVMTGKGPFQNLVEHLADPVNNNILTNFAGRVSGSSQPWRPHGWWRRRYRSVAALALIRNRSVC

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23446.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

AAVRPVWFPGNPPPAHLDGSLAGDYGFDPLFLGQEPQTLKWYVQAELVHGRFAMLGAAGIILTSIGAKVGLGFPEWYDAGKVVVEKNNIDFPTLMVIQFYLMGWAETKRWYDFKNPGSQADGSFLGFTEEFKGLENGYPGGRFFDPMGLSRGDAAKYQEYKQKEVKNGRLAMIACLGFAAQYAATGKGPLDNLADHLADPNHVNFATNGVSIPIA

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23293.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

RQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALRWYQQAELIHCRTAMAGVAGILIPGLLTKAGALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQGEPGSFLGFEASLKGTSELGYPGGPFDPLGLSKEADKWADWKLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWHVNYATNGVSLPFL

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25906.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

SAVPENVKEAREWIDAWKSKSGGAKRDAALPSWMPGADLPGYLNGTLPGDFGFDPLYLGQDPVKLKWYAQAELMNARFAMLAVAGILVPELLSNIGFSWPGAGVAWYDAGKFEYFAPASSLFGVQMLLFAWVEIRRYQDFVKPGSANQDPIFTNNKLPDGNEPGYPGGIFDPFGWSKGDIKSLKLKEIKNGRLAMLAFAGFIGQAYTTGTTPLKNLSTHLADPWSTTVWQNDLARL

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 17 Entity 17 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25265.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

AADRKLWAPGVVAPEYLKGDLAGDYGWDPLGLGADPTALKWYRQSELQHARWAMLGVAGVLVQEIVKPDVYFYEAGLPQNLPEPFTNINMGGLLAWEFILMHWVEVRRWQDYKNFGSVNEDPIFKGNKVPNPEMGYPGGIFDPFGFSKGNLKELQTKEIKNGRLAMIAYMAFILQAQATGKGPLAALSAHLSNPFGNNILKNIGTCTVPHSVDVQGLTIPLTCLWPGSQ

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 18 Entity 18 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25183.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

ASSRPLWLPGSTPPAHLKGDLPGDFGFDPLGLGANAESLKWFKESELVHSRWAMAAVAGILVQEIVRPDVFWYNAGKEVESPLGPLGLLAVEFFLMHWVEVRRWQDLRKPGSVDQDPIFSQYKLPPHEVGYPGGVFAPFIPGDLAELKVKEIKNGRLAMLAFVGFVMAAQVTGKGPIAALQEHLADPWGTTIFSKAAVVPGQAVAPPCKIPASVSYKGIEIPTPCFLQGLWP

Source Source

Source organism organism	Chlamydomonas reinhardtii
Common name common_name	Chlamydomonas smithii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Chlamydomonas reinhardtii

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 20 Entity 20 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	197

Entity 21 Entity 21 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 22 Entity 22 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 23 Entity 23 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	32

Entity 24 Entity 24 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 25 Entity 25 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 26 Entity 26 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 27 Entity 27 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 28 Entity 28 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	18

▼

6. Fold Classification (SCOP + CATH) 25 domains

SCOP 2.08 (15 domains)

Domain ID domain_id	d6jo61_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6jo63_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6jo64_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6jo65_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6jo67_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6jo68_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6jo6a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d6jo6b_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d6jo6c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d6jo6d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d6jo6e_
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.0 — automated matches

Domain ID domain_id	d6jo6f_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.0 — automated matches

Domain ID domain_id	d6jo6j_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.0 — automated matches

Domain ID domain_id	d6jo6l_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.31 — Photosystem I reaction center subunit XI, PsaL
Superfamily Superfamily superfamily	f.31.1 — Photosystem I reaction center subunit XI, PsaL
Family Family family	f.31.1.0 — automated matches

Domain ID domain_id	d6jo6z_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

CATH v4.4 (10 domains)

Domain ID domain_id	6jo6500
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6jo6601
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6jo6701
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6jo6A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	6jo6B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	6jo6C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6jo6D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	6jo6E00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	6jo6F00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	6jo6L01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	379749

Structure of the green algal photosystem I supercomplex with light-harvesting complex I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit V, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit psaK, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer