9se6

Structure of Photosystem I from Chlamydomonas reinhardtii at 1.83 A resolution

Method: ELECTRON MICROSCOPY D_max: 174.9 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Light-harvesting chlorophyll-a/b protein of photosystem I, type III

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain 3； UniProt 44–264	Mutation：No	Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0ABF7PHF8_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 3； PDBConstruct 1–221； UniProt 44–264

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VZ0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain 4； UniProt 53–264	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 4 29–264（236 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 4 29–264（236 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 4 55–264（210 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 4 55–264（210 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 4 58–262（205 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 4 1–264（264 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 4 1–264（264 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 4 55–264（210 aa） Chain t 55–264（210 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain 4 1–264（264 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain 4 1–264（264 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain 4 1–264（264 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 4 1–264（264 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain 4 1–264（264 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 4 1–264（264 aa） Chain 42 1–264（264 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain 4 1–264（264 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q75VZ0_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 4； PDBConstruct 1–212； UniProt 53–264

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain 5； UniProt 31–257	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 5 29–257（229 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 5 29–257（229 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 5 31–257（227 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 5 31–257（227 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 5 32–256（225 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 5 1–257（257 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 5 1–257（257 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 5 31–257（227 aa） Chain u 31–257（227 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain 5 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain 5 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain 5 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 5 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain 5 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 5 1–257（257 aa） Chain 52 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain 5 1–257（257 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q75VY8_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 5； PDBConstruct 1–227； UniProt 31–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain 6； UniProt 28–257	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 6 26–257（232 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 6 26–257（232 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 6 29–257（229 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 6 29–257（229 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 6 28–257（230 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 6 1–257（257 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 6 1–257（257 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 6 29–257（229 aa） Chain v 29–257（229 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain 6 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain 6 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain 6 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 6 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain 6 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 6 1–257（257 aa） Chain 62 1–257（257 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain 6 1–257（257 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q75VY6_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 6； PDBConstruct 1–230； UniProt 28–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q84Y02

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain 7； UniProt 29–241	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 7 27–241（215 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 7 27–241（215 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 7 29–241（213 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 7 29–241（213 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 7 1–241（241 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 7 1–241（241 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 7 29–241（213 aa） Chain r 29–241（213 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain 7 1–241（241 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain 7 1–241（241 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain 7 1–241（241 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 7 1–241（241 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain 7 1–241（241 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 7 1–241（241 aa） Chain 72 1–241（241 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q84Y02_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 7； PDBConstruct 1–213； UniProt 29–241

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain 8； UniProt 27–243	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 8 27–243（217 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 8 27–243（217 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 8 27–243（217 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 8 27–243（217 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 8 27–243（217 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 8 1–243（243 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 8 1–243（243 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 8 27–243（217 aa） Chain s 27–243（217 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain 8 1–243（243 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain 8 1–243（243 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain 8 1–243（243 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain 8 1–243（243 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain 8 1–243（243 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 8 1–243（243 aa） Chain 82 1–243（243 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain 8 1–243（243 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q75VY7_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 8； PDBConstruct 1–217； UniProt 27–243

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

UniProt P12154

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain A； UniProt 10–751	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain A 1–751（751 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain A 1–751（751 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain A 11–751（741 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain A 11–751（741 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain A 12–751（740 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain A 1–751（751 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain A 1–751（751 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain A 11–751（741 aa） Chain a 11–751（741 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 1–751（751 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain A 1–751（751 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 1–751（751 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 1–751（751 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain A 1–751（751 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain A 1–751（751 aa） Chain A2 1–751（751 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain A 1–751（751 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359
9SE7 Structure of Cytochrome C6 bound Photosystem I from Chlamydomonas reinhardtii at 2.07 A resolution Deposited 2025-08-15	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 10–751（742 aa）	Not recorded	CLA CHLOROPHYLL A × 91 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 BCR BETA-CAROTENE × 15 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 2 HEC HEME C × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSAA_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 1–742； UniProt 10–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P09144

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain B； UniProt 3–735	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain B 1–735（735 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain B 1–735（735 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain B 2–734（733 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain B 2–734（733 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain B 2–735（734 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain B 1–735（735 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain B 1–735（735 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain B 2–734（733 aa） Chain b 2–734（733 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain B 1–735（735 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain B 1–735（735 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 1–735（735 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 1–735（735 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain B 1–735（735 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain B 1–735（735 aa） Chain B2 1–735（735 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain B 1–735（735 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359
9SE7 Structure of Cytochrome C6 bound Photosystem I from Chlamydomonas reinhardtii at 2.07 A resolution Deposited 2025-08-15	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain B 3–735（733 aa）	Not recorded	CLA CHLOROPHYLL A × 91 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 BCR BETA-CAROTENE × 15 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 2 HEC HEME C × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSAB_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B； PDBConstruct 1–733； UniProt 3–735

Photosystem I iron-sulfur center

OrganismNot specified

UniProt Q00914

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain C； UniProt 2–81	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain C 1–81（81 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain C 1–81（81 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain C 2–81（80 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain C 2–81（80 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain C 2–81（80 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain C 1–81（81 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain C 1–81（81 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain C 2–81（80 aa） Chain c 2–81（80 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain C 1–81（81 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain C 1–81（81 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain C 1–81（81 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain C 1–81（81 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain C 1–81（81 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain C 1–81（81 aa） Chain C2 1–81（81 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain C 1–81（81 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359
9SE7 Structure of Cytochrome C6 bound Photosystem I from Chlamydomonas reinhardtii at 2.07 A resolution Deposited 2025-08-15	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 2–81（80 aa）	Not recorded	CLA CHLOROPHYLL A × 91 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 BCR BETA-CAROTENE × 15 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 2 HEC HEME C × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSAC_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit II, chloroplastic

OrganismNot specified

UniProt Q39615

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain D； UniProt 53–196	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain D 36–196（161 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain D 36–196（161 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain D 53–196（144 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain D 53–196（144 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain D 53–196（144 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain D 1–196（196 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain D 1–196（196 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain D 53–196（144 aa） Chain d 53–196（144 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain D 1–196（196 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain D 1–196（196 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 1–196（196 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain D 1–196（196 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain D 1–196（196 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain D 1–196（196 aa） Chain D2 1–196（196 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain D 1–196（196 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359
9SE7 Structure of Cytochrome C6 bound Photosystem I from Chlamydomonas reinhardtii at 2.07 A resolution Deposited 2025-08-15	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain D 53–196（144 aa）	Not recorded	CLA CHLOROPHYLL A × 91 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 BCR BETA-CAROTENE × 15 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 2 HEC HEME C × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSAD_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain D； PDBConstruct 1–144； UniProt 53–196

Photosystem I reaction center subunit IV, chloroplastic

OrganismNot specified

UniProt P12352

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain E； UniProt 34–97	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain E 25–97（73 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain E 25–97（73 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain E 34–96（63 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain E 34–96（63 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain E 34–96（63 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain E 1–97（97 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain E 1–97（97 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain E 34–96（63 aa） Chain e 34–96（63 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain E 1–97（97 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain E 1–97（97 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain E 1–97（97 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain E 1–97（97 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain E 1–97（97 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain E 1–97（97 aa） Chain E2 1–97（97 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain E 1–97（97 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359
9SE7 Structure of Cytochrome C6 bound Photosystem I from Chlamydomonas reinhardtii at 2.07 A resolution Deposited 2025-08-15	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 34–97（64 aa）	Not recorded	CLA CHLOROPHYLL A × 91 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 BCR BETA-CAROTENE × 15 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 2 HEC HEME C × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSAE_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain E； PDBConstruct 1–64； UniProt 34–97

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt A8IFG7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain I； UniProt 68–104	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain I 1–106（106 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain I 1–106（106 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain I 68–104（37 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain I 68–104（37 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain I 68–104（37 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain I 1–106（106 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain I 1–106（106 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain I 68–104（37 aa） Chain i 68–104（37 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain I 1–106（106 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain I 1–106（106 aa） Chain I2 1–106（106 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain I 1–106（106 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain I 1–106（106 aa） Chain I2 1–106（106 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain I 1–106（106 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359
9SE7 Structure of Cytochrome C6 bound Photosystem I from Chlamydomonas reinhardtii at 2.07 A resolution Deposited 2025-08-15	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 68–104（37 aa）	Not recorded	CLA CHLOROPHYLL A × 91 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 BCR BETA-CAROTENE × 15 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 2 HEC HEME C × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A8IFG7_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain I； PDBConstruct 1–37； UniProt 68–104

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P59777

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain J； UniProt 1–40	Non-standard monomer：Yes (specific site not provided by mmCIF)	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain J 1–41（41 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain J 1–41（41 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain J 1–39（39 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain J 1–39（39 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain J 1–41（41 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain J 1–41（41 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain J 1–41（41 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain J 1–39（39 aa） Chain j 1–39（39 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain J 1–41（41 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain J 1–41（41 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain J 1–41（41 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain J 1–40（40 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain J 1–40（40 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain J 1–40（40 aa） Chain J2 1–40（40 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain J 1–41（41 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359
9SE7 Structure of Cytochrome C6 bound Photosystem I from Chlamydomonas reinhardtii at 2.07 A resolution Deposited 2025-08-15	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain J 1–40（40 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CLA CHLOROPHYLL A × 91 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 BCR BETA-CAROTENE × 15 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 2 HEC HEME C × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSAJ_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain J； PDBConstruct 2–41； UniProt 1–40

Photosystem I reaction center subunit psaK, chloroplastic

OrganismNot specified

UniProt P14225

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain K； UniProt 28–113	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain K 27–113（87 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain K 27–113（87 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain K 29–112（84 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain K 29–112（84 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain K 29–113（85 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain K 1–113（113 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain K 1–113（113 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain K 29–112（84 aa） Chain k 29–112（84 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain K 1–113（113 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain K 1–113（113 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain K 1–113（113 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain K 1–113（113 aa） Chain K2 1–113（113 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain K 1–113（113 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSAK_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain K； PDBConstruct 1–86； UniProt 28–113

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q7DM26

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain 1； UniProt 31–224 Chain Z； UniProt 31–224	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 1 31–224（194 aa） Chain Z 31–224（194 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 1 31–224（194 aa） Chain Z 31–224（194 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 1 31–224（194 aa） Chain Z 31–224（194 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain 1 31–224（194 aa） Chain Z 31–224（194 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain 1 31–224（194 aa） Chain a 31–224（194 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain 1 31–224（194 aa） Chain Z 31–224（194 aa） Chain p 31–224（194 aa） Chain z 31–224（194 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain 1 1–224（224 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain 1 1–224（224 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q7DM26_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 1； PDBConstruct 1–194； UniProt 31–224 Author chain Z； PDBConstruct 1–194； UniProt 31–224

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt P12356

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain F； UniProt 63–227	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain F 63–227（165 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain F 63–227（165 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain F 63–227（165 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain F 63–227（165 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain F 63–227（165 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain F 1–227（227 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain F 1–227（227 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain F 63–227（165 aa） Chain f 63–227（165 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain F 1–227（227 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7WYI Native Photosystem I of Chlamydomonas reinhardtii Deposited 2022-02-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain F 1–227（227 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 155 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 4 seconds using Whatman #1 before plunge freezing.	Resolution 3.90 Å
7WZN PSI-LHCI from Chlamydomonas reinhardtii with bound ferredoxin Deposited 2022-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain F 1–227（227 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 188 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 CHL CHLOROPHYLL B × 16 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；2.6 microliter of sample were applied to cryo-grids and blotted for 3.5 seconds using Whatman #1 before plunge freezing.	Resolution 4.90 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain F 1–227（227 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain F 1–227（227 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain F 1–227（227 aa） Chain F2 1–227（227 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain F 1–227（227 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359
9SE7 Structure of Cytochrome C6 bound Photosystem I from Chlamydomonas reinhardtii at 2.07 A resolution Deposited 2025-08-15	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 63–227（165 aa）	Not recorded	CLA CHLOROPHYLL A × 91 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 BCR BETA-CAROTENE × 15 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 2 HEC HEME C × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.06 Å

16 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSAF_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain F； PDBConstruct 1–165； UniProt 63–227

Photosystem I reaction center subunit V, chloroplastic

OrganismNot specified

UniProt P14224

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 19 PDB declaration: 19-meric（19） Consistent with protein copy count	Chain G； UniProt 32–126	Not recorded	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Chains: L × 1 CLA CHLOROPHYLL A × 188 CHL CHLOROPHYLL B × 28 BCR BETA-CAROTENE × 27 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 LMU DODECYL-ALPHA-D-MALTOSIDE × 27 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2 CL0 CHLOROPHYLL A ISOMER × 1 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；5mM HEPES, pH 7.5, 0.02% alphaDDM cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 1.83 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9SE6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6JO5 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain G 31–124（94 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 218 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHL CHLOROPHYLL B × 20 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6JO6 Structure of the green algal photosystem I supercomplex with light-harvesting complex I Deposited 2019-03-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain G 31–124（94 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 BCR BETA-CAROTENE × 32 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHL CHLOROPHYLL B × 18 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BGI Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain G 32–122（91 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 217 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 8 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 T7X Phosphatidylinositol × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 CHL CHLOROPHYLL B × 25 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7BLX Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain G 32–122（91 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 197 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 31 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 NKP (2R)-2-hydroxy-3-(phosphonooxy)propyl (9E)-octadec-9-enoate × 3 LMT DODECYL-BETA-D-MALTOSIDE × 7 OCA OCTANOIC ACID (CAPRYLIC ACID) × 1 DAO LAURIC ACID × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 DGA DIACYL GLYCEROL × 1 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 1 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 SPH SPHINGOSINE × 3 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 17 CHL CHLOROPHYLL B × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 QTB (3~{E},5~{E},7~{E})-6-methyl-8-[(6~{R})-2,2,6-trimethylcyclohexyl]octa-3,5,7-trien-2-one × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 PLM PALMITIC ACID × 1 LPX (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-hydroxypropyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain G 32–122（91 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain G 1–126（126 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain G 1–126（126 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7O01 Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii Deposited 2021-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain G 32–122（91 aa） Chain g 32–122（91 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.10 Å
7R3K Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex Deposited 2022-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain G 1–126（126 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 186 PQN PHYLLOQUINONE × 2 SF4 IRON/SULFUR CLUSTER × 3 BCR BETA-CAROTENE × 28 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 LMT DODECYL-BETA-D-MALTOSIDE × 16 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CA CALCIUM ION × 1 RRX (3R)-beta,beta-caroten-3-ol × 3 C7Z (1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 DAO LAURIC ACID × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHL CHLOROPHYLL B × 28 SPH SPHINGOSINE × 3 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DGA DIACYL GLYCEROL × 1 PLM PALMITIC ACID × 1 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERG ERGOSTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 2.52 Å
7ZQ9 Dimeric PSI of Chlamydomonas reinhardtii at 2.74 A resolution (symmetry expanded) Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain G 1–126（126 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 226 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 16 BCR BETA-CAROTENE × 36 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 34 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 17 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 32 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.74 Å
7ZQC Monomeric PSI of Chlamydomonas reinhardtii at 2.31 A resolution Deposited 2022-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain G 1–126（126 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 1 CLA CHLOROPHYLL A × 198 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 BCR BETA-CAROTENE × 27 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 32 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CHL CHLOROPHYLL B × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 7 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.31 Å
7ZQD Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution Deposited 2022-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain G 1–126（126 aa） Chain G2 1–126（126 aa）	Not recorded	CL0 CHLOROPHYLL A ISOMER × 2 CLA CHLOROPHYLL A × 396 PQN PHYLLOQUINONE × 4 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BCR BETA-CAROTENE × 56 SF4 IRON/SULFUR CLUSTER × 6 LMU DODECYL-ALPHA-D-MALTOSIDE × 66 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHL CHLOROPHYLL B × 60 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
8H2U X-ray Structure of photosystem I-LHCI super complex from Chlamydomonas reinhardtii. Deposited 2022-10-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain G 1–126（126 aa）	Not recorded	CLA CHLOROPHYLL A × 185 SF4 IRON/SULFUR CLUSTER × 3 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 7 BCR BETA-CAROTENE × 27 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 LMT DODECYL-BETA-D-MALTOSIDE × 2 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHL CHLOROPHYLL B × 26 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；50 mM Tris-HCl (pH 7.0), 50 mM Li2SO4 and 4.5-7.0 % (w/v) polyethylene glycol (PEG) 6,000	Resolution 3.40 Å R-free 0.359

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSAG_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain G； PDBConstruct 1–95； UniProt 32–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9se6
Deposition date deposition_date	2025-08-15
Structure title title	Structure of Photosystem I from Chlamydomonas reinhardtii at 1.83 A resolution
Keywords keywords	Photosystem I, Chlamydomonas reinhardtii, CryoEM, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	60.25 Å
Radius of gyration Rg (electron density) rg_electron	59.80 Å
Forward intensity I(0) i0	3405490000.00
Molecular weight molecular_weight	665000.0 kDa
Excluded volume excluded_volume	895450 Å³
Envelope volume envelope_volume	1076400 Å³
Hydration-shell volume shell_volume	143130 Å³
Envelope diameter envelope_diameter	188.1 Å
Shell Rg shell_rg	65.37 Å
Envelope Rg envelope_rg	59.39 Å
Shape Rg shape_rg	59.82 Å
Total Rg total_rg	59.85 Å
Total atoms total_atoms	47459
Residues n_residues	3993
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	174.9 Å
Rg (real space) rg_real	60.04 Å
Rg uncertainty (real space) rg_real_error	0.93 Å
I(0) (real space) i0_real	3.4050e+09
I(0) uncertainty (real space) i0_real_error	5.9800e+07
Rg (reciprocal space) rg_reciprocal	60.40 Å
I(0) (reciprocal space) i0_reciprocal	3407000000.0000
Solution quality estimate total_estimate	0.8450
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	67.3 Å
Skewness Skewness skewness	0.179
Kurtosis Kurtosis kurtosis	-0.630
Angular range angular_range	— – 0.1300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	611000000.0000
Real-space data points n_real_points	27
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.994; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.002

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (32)

Entity 1 Entity 1 polymer

Description description	Light-harvesting chlorophyll-a/b protein of photosystem I, type III
Molecular weight formula_weight	23888.2 kDa
Mutation mutation	No
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3
Atom count atom_count	48478

QLYVGASQSSLAYLDGSLPGDFGFDPLGLLDPVNSGGFIEPKWLQYSEVIHARWAMLGAAGCIAPEVLGAAGLIPDATNIKWFESGVIPPAGSYNGYWADPYTIFFVEIVAMQFAELRRLQDFRYPGSMGQQYFLGLEAIFKGSGDAAYPGGPFFNLFNLGKTEAAMKELKLKEIKNGRLAMLAMLGYGAQAVMTGKGPFQNLVEHLADPVNNNILTNFAG

Entity 2 Entity 2 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23304.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

KRDAALPSWMPGADLPGYLNGTLPGDFGFDPLYLGQDPVKLKWYAQAELMNARFAMLAVAGILVPELLSNIGFSWPGAGVAWYDAGKFEYFAPASSLFGVQMLLFAWVEIRRYQDFVKPGSANQDPIFTNNKLPDGNEPGYPGGIFDPFGWSKGDIKSLKLKEIKNGRLAMLAFAGFIGQAYTTGTTPLKNLSTHLADPWSTTVWQNDLARL

Entity 3 Entity 3 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25122.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

DRKLWAPGVVAPEYLKGDLAGDYGWDPLGLGADPTALKWYRQSELQHARWAMLGVAGVLVQEIVKPDVYFYEAGLPQNLPEPFTNINMGGLLAWEFILMHWVEVRRWQDYKNFGSVNEDPIFKGNKVPNPEMGYPGGIFDPFGFSKGNLKELQTKEIKNGRLAMIAYMAFILQAQATGKGPLAALSAHLSNPFGNNILKNIGTCTVPHSVDVQGLTIPLTCLWPGSQ

Entity 4 Entity 4 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25025.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

SRPLWLPGSTPPAHLKGDLPGDFGFDPLGLGANAESLKWFKESELVHSRWAMAAVAGILVQEIVRPDVFWYNAGKEVESPLGPLGLLAVEFFLMHWVEVRRWQDLRKPGSVDQDPIFSQYKLPPHEVGYPGGVFAPFIPGDLAELKVKEIKNGRLAMLAFVGFVMAAQVTGKGPIAALQEHLADPWGTTIFSKAAVVPGQAVAPPCKIPASVSYKGIEIPTPCFLQGLWP

Entity 5 Entity 5 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23304.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

VRPVWFPGNPPPAHLDGSLAGDYGFDPLFLGQEPQTLKWYVQAELVHGRFAMLGAAGIILTSIGAKVGLGFPEWYDAGKVVVEKNNIDFPTLMVIQFYLMGWAETKRWYDFKNPGSQADGSFLGFTEEFKGLENGYPGGRFFDPMGLSRGDAAKYQEYKQKEVKNGRLAMIACLGFAAQYAATGKGPLDNLADHLADPNHVNFATNGVSIPIA

Entity 6 Entity 6 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23293.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

RQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALRWYQQAELIHCRTAMAGVAGILIPGLLTKAGALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQGEPGSFLGFEASLKGTSELGYPGGPFDPLGLSKEADKWADWKLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWHVNYATNGVSLPFL

Entity 7 Entity 7 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82193.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

AKKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG

Entity 8 Entity 8 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81982.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TKLFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVTDPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRFG

Entity 9 Entity 9 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8738.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

AHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSY

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	16123.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

WTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMMSPAEI

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	7151.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

EVGPKRGSLVKILRPESYWFNQVGKVVSVDQSGVRYPVVVRFENQNYAGVTTNNYALDEVVAAK

Entity 12 Entity 12 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3970.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

PFVPPSWAPSVFVPLTGLVLPAIAMATLFVYIEKEAP

Entity 13 Entity 13 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4629.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

XMKDFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVFS

Entity 14 Entity 14 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	8316.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

GFIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVISNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	20368.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,1

KAGNWLPGSDAPAWLPDDLPGNYGFDPLSLGKEPASLKRFTESEVIHGRWAMLGVAGSLAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVVYPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLANPWGANFATNGISVPFF

Entity 16 Entity 16 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17957.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTKARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGYIGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQRGTLLEKEENITVSPR

Entity 17 Entity 17 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	9958.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

LDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQGANLS

Entity 18 Entity 18 polymer

Description description	Chains: L
Molecular weight formula_weight	12744.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

GMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVEIGLAHGFLLAGPFIKLGPLRNVPETAEIAGSLSAAGLVLILALCLSIYGSAQFQSARDPLFSADGWSEFAAGFLVGGEAGVAWAYVCTQ

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	188

Entity 20 Entity 20 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 21 Entity 21 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 22 Entity 22 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 23 Entity 23 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 24 Entity 24 non-polymer

Description description	DODECYL-ALPHA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 25 Entity 25 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 26 Entity 26 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 27 Entity 27 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 29 Entity 29 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 31 Entity 31 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 32 Entity 32 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1019

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	1.83 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	246159

fit	/app/data/saxs_computation/se/9se6/9se6.fit
pddf	/app/data/pr_computation/se/9se6/9se6.pr.out
profile	/app/data/saxs_computation/se/9se6/9se6.dat

Structure of Photosystem I from Chlamydomonas reinhardtii at 1.83 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Light-harvesting chlorophyll-a/b protein of photosystem I, type III

State in the Current Structure

Other States of the Same Protein in the Database

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I reaction center subunit II, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I reaction center subunit IV, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I reaction center subunit psaK, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Photosystem I reaction center subunit V, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (32)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer