6kac

Cryo-EM structure of the C2S2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–352； UniProt 1–352 Author chain a； PDBConstruct 1–352； UniProt 1–352

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt P37255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBB_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–508； UniProt 1–508 Author chain b； PDBConstruct 1–508； UniProt 1–508

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt P10898

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–461； UniProt 1–461 Author chain c； PDBConstruct 1–461； UniProt 1–461

Photosystem II D2 protein

OrganismNot specified

UniProt P06007

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–352； UniProt 1–352 Author chain d； PDBConstruct 1–352； UniProt 1–352

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt P48268

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–82； UniProt 1–82 Author chain e； PDBConstruct 1–82； UniProt 1–82

Cytochrome b559 subunit beta

OrganismNot specified

UniProt Q08363

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain F； PDBConstruct 1–44； UniProt 1–44 Author chain f； PDBConstruct 1–44； UniProt 1–44

Photosystem II reaction center protein H

OrganismNot specified

UniProt P22666

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–88； UniProt 1–88 Author chain h； PDBConstruct 1–88； UniProt 1–88

Photosystem II reaction center protein I

OrganismNot specified

UniProt P59763

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–37； UniProt 1–37 Author chain i； PDBConstruct 1–37； UniProt 1–37

Photosystem II reaction center protein J

OrganismNot specified

UniProt O19930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBJ_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42 Author chain j； PDBConstruct 1–42； UniProt 1–42

Photosystem II reaction center protein K

OrganismNot specified

UniProt P18263

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–46； UniProt 1–46 Author chain k； PDBConstruct 1–46； UniProt 1–46

Photosystem II reaction center protein L

OrganismNot specified

UniProt P32974

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–38； UniProt 1–38 Author chain l； PDBConstruct 1–38； UniProt 1–38

Photosystem II reaction center protein M

OrganismNot specified

UniProt P92277

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–34； UniProt 1–34 Author chain m； PDBConstruct 1–34； UniProt 1–34

Oxygen-evolving enhancer protein 1, chloroplastic

OrganismNot specified

UniProt P12853

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBO_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain O； PDBConstruct 1–291； UniProt 1–291 Author chain o； PDBConstruct 1–291； UniProt 1–291

Oxygen-evolving enhancer protein 2, chloroplastic

OrganismNot specified

UniProt P11471

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBP_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain P； PDBConstruct 1–245； UniProt 1–245 Author chain p； PDBConstruct 1–245； UniProt 1–245

Oxygen-evolving enhancer protein 3, chloroplastic

OrganismNot specified

UniProt P12852

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBQ_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Q； PDBConstruct 1–199； UniProt 1–199 Author chain q； PDBConstruct 1–199； UniProt 1–199

Photosystem II reaction center protein T

OrganismNot specified

UniProt P37256

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain T； PDBConstruct 1–31； UniProt 1–31 Author chain t； PDBConstruct 1–31； UniProt 1–31

Photosystem II reaction center W protein, chloroplastic

OrganismNot specified

UniProt Q9SPI9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBW_CHLRE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain W； PDBConstruct 1–115； UniProt 1–115 Author chain w； PDBConstruct 1–115； UniProt 1–115

4.1 kDa photosystem II subunit

OrganismNot specified

UniProt A8I846

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8I846_CHLRE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain X； PDBConstruct 1–101； UniProt 1–101 Author chain x； PDBConstruct 1–101； UniProt 1–101

Photosystem II reaction center protein Z

OrganismNot specified

UniProt P92276

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_CHLRE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62 Author chain z； PDBConstruct 1–62； UniProt 1–62

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q93WL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93WL4_CHLRE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain N； PDBConstruct 1–257； UniProt 1–257 Author chain n； PDBConstruct 1–257； UniProt 1–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q93WE0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93WE0_CHLRE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain G； PDBConstruct 1–249； UniProt 1–249 Author chain g； PDBConstruct 1–249； UniProt 1–249

Chlorophyll a-b binding protein CP29

OrganismNot specified

UniProt Q93WD2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB29_CHLRE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain R； PDBConstruct 1–280； UniProt 1–280 Author chain r； PDBConstruct 1–280； UniProt 1–280

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q9FEK6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9FEK6_CHLRE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain S； PDBConstruct 1–289； UniProt 1–289 Author chain s； PDBConstruct 1–289； UniProt 1–289

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q93VE0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Predicted protein × 2 （A8I5A0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93VE0_CHLRE
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain Y； PDBConstruct 1–256； UniProt 1–256 Author chain y； PDBConstruct 1–256； UniProt 1–256

Predicted protein

OrganismNot specified

UniProt A8I5A0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II reaction center protein Ycf12 × 2 Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P11471） Oxygen-evolving enhancer protein 3, chloroplastic × 2 （P12852） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93WE0） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Chlorophyll a-b binding protein, chloroplastic × 2 （Q93VE0） 10 kDa photosystem II polypeptide PsbR (potential) × 2 Unindentified Stromal Protein (USP) × 2 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 CHLOROPHYLL A × 148 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 DODECYL-ALPHA-D-MALTOSIDE × 6 CHLOROPHYLL B × 50 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8I5A0_CHLRE
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain U； PDBConstruct 1–178； UniProt 1–178 Author chain u； PDBConstruct 1–178； UniProt 1–178

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6kac
Deposition date deposition_date	2019-06-21
Structure title title	Cryo-EM structure of the C2S2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii
Keywords keywords	PhotosystemII, supercomplex, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6kac__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6kac__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6kac__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	74.74 Å
Rg (electron density)	75.62 Å
Total Rg	75.17 Å
Atom count	77352
Residues	7858
Excluded volume	1433200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6kac__assembly_1__model_1`	56-meric （56）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (47)

Entity 1 Entity 1 polymer

Description description	Photosystem II protein D1
Molecular weight formula_weight	39066.3 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	77947

MTAILERRENSSLWARFCEWITSTENRLYIGWFGVIMIPCLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFLLGVYCYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGLSTMAFNLNGFNFNQSVVDSQGRVLNTWADIINRANLGMEVMHERNAHNFPLDLASTNSSSNN

Entity 2 Entity 2 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	56159.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

MGLPWYRVHTVVINDPGRLISVHLMHTALVSGWAGSMALFEISVFDPSDPVLNPMWRQGMFVLPFMTRLGITQSWGGWTISGETATNPGIWSYEGVAAAHIILSGALFLASVWHWTYWDLELFRDPRTGKTALDLPKIFGIHLFLSGLLCFGFGAFHVTGVFGPGIWVSDPYGLTGRVQPVAPSWGADGFDPYNPGGIASHHIAAGILGVLAGLFHLCVRPSIRLYFGLSMGSIETVLSSSIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIQKRVQASLAEGASLSDAWSRIPEKLAFYDYIGNNPAKGGLFRTGAMNSGDGIAVGWLGHASFKDQEGRELFVRRMPTFFETFPVLLLDKDGIVRADVPFRKAESKYSIEQVGVSVTFYGGELDGLTFTDPATVKKYARKAQLGEIFEFDRSTLQSDGVFRSSPRGWFTFGHVCFALLFFFGHIWHGARTIFRDVFAGIDDDINDQVEFGKYKKLGDTSSLREAF

Entity 3 Entity 3 polymer

Description description	Photosystem II reaction center protein Ycf12
Molecular weight formula_weight	3333.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,v

MNIELALTLVSLVLVVSAGPLVVVLLSARGGNL

Entity 4 Entity 4 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	50680.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

METLFNGTLTVGGRDQETTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVSHFVPEKPMYEQGLILLPHIATLGYGVGPGGEIIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESYPFFGYVWKDKNKMTNILGYHLIMLGLGAWLLVWKAMYFGGVYDTWAPGGGDVRVITNPTTNAAVIFGYLVKSPFGGDGWICSVDNMEDIIGGHIWIGTLEILGGIWHIYTTPWPWARRAFVWSGEAYLSYSLGAIGVMGFIACCMSWFNNTAYPSEFYGPTGPEASQSQAFTFLVRDQRLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKLKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLACSHFCLGFFFFIGHLWHAGRARAAAAGFEKGIDRFDEPVLSMRPLD

Entity 5 Entity 5 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39474.0 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MTIAIGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWYTHGLATSYLEGCNFLTAAVSTPANSMAHSLLFVWGPEAQGDFTRWCQLGGLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL

Entity 6 Entity 6 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9312.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MAGKPVERPFSDILTSIRYWVIHSITVPALFIAGWLFVSTGLAYDVFGTPRPNEYFTEDRQEAPLITDRFNALEQVKKLSGN

Entity 7 Entity 7 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	4986.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MTTKKSAEVLVYPIFTVRWLAIHGIAVPTIFFLGAITAMQFIQR

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	9445.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

MATGTSKAKPSKVNSDFQEPGLVTPLGTLLRPLNSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLILDDVSMSWETLAKVS

Entity 9 Entity 9 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4245.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MLTLKIFVYTVVTFFVCLFIFGFLSNDPARNPGKNLD

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein J
Molecular weight formula_weight	4291.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MSNTGTTGRIPLWLVGTVVGTLAIGLLAVFFYGSYVGLGSSL

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	5062.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

MTTLALVLAKLPEAYAPFAPIVDVLPVIPVFFILLAFVWQAAVSFR

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4431.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MARPNPNKQVVELNRTSLYWGLLLIFVLAVLFSSYIFN

Entity 13 Entity 13 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3762.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

MEVNIYGLTATALFIIIPTSFLLILYVKTASTQD

Entity 14 Entity 14 polymer

Description description	Oxygen-evolving enhancer protein 1, chloroplastic
Molecular weight formula_weight	30557.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,o

MALRAAQSAKAGVRAARPNRATAVVCKAQKVGQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDGIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPARADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK

Entity 15 Entity 15 polymer

Description description	Oxygen-evolving enhancer protein 2, chloroplastic
Molecular weight formula_weight	25930.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,p

MATALCNKAFAAAPVARPASRRSAVVVRASGSDVSRRAALAGFAGAAALVSSSPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLLPAKWNPSKENDFPGVILRYEDNFDAVNNLVVIAQDTDKKAIADFGSQDKFLESVSYLLGKQAYSGETQSEGGFAPNRVSAASLLDVSTTTDKKGKTYYKYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKKEAMGAFDSFTVV

Entity 16 Entity 16 polymer

Description description	Oxygen-evolving enhancer protein 3, chloroplastic
Molecular weight formula_weight	21860.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,q

MALASKVATRPAVASRRGAVVVRASGESRRAVLGGLLASAVAAVAPKAALALTPVDLFDDRSVRDRGFDLIYEARDLDLPQNVREGFTQARASLDETKKRVKESEARIDADLDVFIQKSYWTEAREQLRRQVGTLRFDLNTLASTKEKEAKKAALGLRKEFIQAVEDLDFALREKDQASAAKKLEITKAKLDSVLAAVL

Entity 17 Entity 17 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3639.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

MEALVYTFLLVGTLGIIFFSIFFRDPPRMIK

Entity 18 Entity 18 polymer

Description description	Photosystem II reaction center W protein, chloroplastic
Molecular weight formula_weight	12155.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,w

MQALSARAPRVAAKPVSRSGARSAVTVVCKATTVRSEVAKKVAMLSTLPATLAAHPAFALVDERMNGDGTGRPFGVNDPVLGWVLLGVFGTMWAIWFIGQKDLGDFEDADDGLKL

Entity 19 Entity 19 polymer

Description description	4.1 kDa photosystem II subunit
Molecular weight formula_weight	9894.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

MAAVCVSSKAVAVRPATRVASRPAARMVVRASAKPAQISEKAIAAGVSAAAAASLALAPIAEAAVTPSLKNFLGSLIAGATVLGGIALAITAVSKFDKTIR

Entity 20 Entity 20 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6565.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MTSILQVALLALIFVSFALVVGVPVVFATPNGWTDNKGAVFSGLSLWLLLVFVVGILNSFVV

Entity 21 Entity 21 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	27405.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,n

MAFALSFSRKALQVSAKATGKKGTGKTAAKQAPASSGIEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKSGTQFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQNIVATLAVQVILMGLVEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHLSNPTVNNAFAFATKFTPSA

Entity 22 Entity 22 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	26675.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,g

MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKNGIPFGEAVWFKAGAQIFAEGGLNYLGNENLIHAQSIIATLAFQVVVMGLAEAYRANGGPLGEGLDPLHPGGAFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHLANPTAVNAFAYATKFTPSA

Entity 23 Entity 23 polymer

Description description	Chlorophyll a-b binding protein CP29
Molecular weight formula_weight	29970.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,r

MVFKFPTPPGTQKKAGTTATKPAPKATTKKVATSTGTRSGGVGYRKYQGDALWLPNTTRPEWLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNAAKNNKGSVEAIVQATPDEVSSENRLAPYSEVFGLARFRECELIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYAGLSLPFSITQLIWIEVILVGGAEFYRNSETNPEKRCYPGGVFDPLKLASEDEERAFRLKTAEIKHARLAMVSFFGYGVQALSTGEGALGSLAKFADGLNNGKGL

Entity 24 Entity 24 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	30742.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,s

MQIQALFKKTGASAPAKKGTASTKVVKPSKAGGKATRGWLGGQGGAADLDKWYGPDRKLFLPSGLYDRSEIPEYLNGELAGDYGYDPLGLGKDPETVAKYRENELLHARWAMLAAAGILIPEGLQANGANIKGGTWFETGAEMLNGGTLNYFAVPWGIVSNPLPLFAVIAVEVGLMGAVEFYRRNGTGPAGYSPGIGKFDSSVFDGLDPLYPGGPFDPLGLADDPEVLQELKVKEIKNGRLAMVSVLGFAVQSYVTGEGPYANWTKHVADPFGYNLLTVLGAEERTPTL

Entity 25 Entity 25 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	27591.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,y

MAFALAKSSARAAVSRRSTVKVEARRTVKPASKASTPDSFWYGPERPLFLGAFTGEPPSYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCIFPELLGSYGVPFGEAVWFKAGAQIFQEGGLDYLGNPNLVHAQSILAILGTQVLLMGAIEGYRVNGGPLGEGLDKLYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLQNLSDHLANPGTNNAFAYATKFTPQ

Entity 26 Entity 26 polymer

Description description	Predicted protein
Molecular weight formula_weight	19116.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,u

MASITCSSGKAAVVSRAKTARPVARRMSVVASAAPQGNASRRELLGLSAVAASLLLSSRPAHAIFGFADDNTALFDTYTAETSAILDKVKVTLALDKDDPAKEDSVKGLRKDINNWVAKYRREPKVSGKPSFGNTYSALNALAGHFNSFGATAPIPKKRLERLQKELDDATLLLTRNR

Entity 27 Entity 27 polymer

Description description	10 kDa photosystem II polypeptide PsbR (potential)
Molecular weight formula_weight	1738.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,0

GAAGAAAAAGAAAAAAAAGAAAAAA

Entity 28 Entity 28 polymer

Description description	Unindentified Stromal Protein (USP)
Molecular weight formula_weight	2380.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,3

AWAAAAGAAGAGYGVYRYEAAYGAA

Entity 29 Entity 29 non-polymer

Description description	CA-MN4-O5 CLUSTER
Molecular weight formula_weight	339.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 31 Entity 31 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 32 Entity 32 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	148

Entity 33 Entity 33 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 34 Entity 34 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 35 Entity 35 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 36 Entity 36 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 37 Entity 37 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 38 Entity 38 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 39 Entity 39 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 40 Entity 40 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 41 Entity 41 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 42 Entity 42 non-polymer

Description description	DODECYL-ALPHA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 43 Entity 43 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	50

Entity 44 Entity 44 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 45 Entity 45 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 46 Entity 46 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 47 Entity 47 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	595

▼

6. Fold Classification (SCOP + CATH) 29 domains

SCOP 2.08 (17 domains)

Domain ID domain_id	d6kaca_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.26 — Bacterial photosystem II reaction centre, L and M subunits
Superfamily Superfamily superfamily	f.26.1 — Bacterial photosystem II reaction centre, L and M subunits
Family Family family	f.26.1.1 — Bacterial photosystem II reaction centre, L and M subunits

Domain ID domain_id	d6kacb_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.55 — Photosystem II antenna protein-like
Superfamily Superfamily superfamily	f.55.1 — Photosystem II antenna protein-like
Family Family family	f.55.1.1 — Photosystem II antenna protein-like

Domain ID domain_id	d6kacc_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.55 — Photosystem II antenna protein-like
Superfamily Superfamily superfamily	f.55.1 — Photosystem II antenna protein-like
Family Family family	f.55.1.1 — Photosystem II antenna protein-like

Domain ID domain_id	d6kacd_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.26 — Bacterial photosystem II reaction centre, L and M subunits
Superfamily Superfamily superfamily	f.26.1 — Bacterial photosystem II reaction centre, L and M subunits
Family Family family	f.26.1.1 — Bacterial photosystem II reaction centre, L and M subunits

Domain ID domain_id	d6kace_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.38 — Cytochrome b559 subunits
Family Family family	f.23.38.1 — Cytochrome b559 subunits

Domain ID domain_id	d6kacf_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.38 — Cytochrome b559 subunits
Family Family family	f.23.38.1 — Cytochrome b559 subunits

Domain ID domain_id	d6kacg_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d6kach_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.33 — Photosystem II 10 kDa phosphoprotein PsbH
Family Family family	f.23.33.0 — automated matches

Domain ID domain_id	d6kacj_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.32 — Photosystem II reaction center protein J, PsbJ
Family Family family	f.23.32.0 — automated matches

Domain ID domain_id	d6kack_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.36 — Photosystem II reaction center protein K, PsbK
Family Family family	f.23.36.1 — PsbK-like

Domain ID domain_id	d6kacm_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.35 — Photosystem II reaction center protein M, PsbM
Family Family family	f.23.35.1 — PsbM-like

Domain ID domain_id	d6kacn_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d6kaco_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.4 — Transmembrane beta-barrels
Superfamily Superfamily superfamily	f.4.1 — OMPA-like
Family Family family	f.4.1.0 — automated matches

Domain ID domain_id	d6kacp_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.107 — Mog1p/PsbP-like
Superfamily Superfamily superfamily	d.107.1 — Mog1p/PsbP-like
Family Family family	d.107.1.0 — automated matches

Domain ID domain_id	d6kacs_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d6kacy_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d6kacz_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.5 — PsbZ-like
Family Family family	f.17.5.0 — automated matches

CATH v4.4 (12 domains)

Domain ID domain_id	6kacB02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	680 — Photosystem II CP47 reaction center protein
Homologous superfamily homologous superfamily	10 — Photosystem II CP47 reaction center protein

Domain ID domain_id	6kacC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	670 — photosystem ii from thermosynechococcus elongatus

Domain ID domain_id	6kacE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

Domain ID domain_id	6kacH01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	880 — Photosystem II reaction center protein H

Domain ID domain_id	6kacP00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1000 — Protein Transport Mog1p; Chain A
Homologous superfamily homologous superfamily	10 — Mog1/PsbP, alpha/beta/alpha sandwich

Domain ID domain_id	6kacZ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	740 — Photosystem II PsbZ, reaction centre

Domain ID domain_id	6kacb02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	680 — Photosystem II CP47 reaction center protein
Homologous superfamily homologous superfamily	10 — Photosystem II CP47 reaction center protein

Domain ID domain_id	6kacc02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	670 — photosystem ii from thermosynechococcus elongatus

Domain ID domain_id	6kace00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

Domain ID domain_id	6kach01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	880 — Photosystem II reaction center protein H

Domain ID domain_id	6kacp00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1000 — Protein Transport Mog1p; Chain A
Homologous superfamily homologous superfamily	10 — Mog1/PsbP, alpha/beta/alpha sandwich

Domain ID domain_id	6kacz00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	740 — Photosystem II PsbZ, reaction centre

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	258242

Cryo-EM structure of the C2S2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer