9imn

Cryo-EM structure of a TEF30-associated intermediate PSII core dimer complex, type I, from Chlamydomonas reinhardtii

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–327； UniProt 10–336 Author chain a； PDBConstruct 1–327； UniProt 10–336

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt P37255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBB_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–480； UniProt 2–481 Author chain b； PDBConstruct 1–480； UniProt 2–481

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt P10898

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–450； UniProt 12–461 Author chain c； PDBConstruct 1–450； UniProt 12–461

Photosystem II D2 protein

OrganismNot specified

UniProt P06007

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–351； UniProt 2–352 Author chain d； PDBConstruct 1–351； UniProt 2–352

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt P48268

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–75； UniProt 8–82 Author chain e； PDBConstruct 1–75； UniProt 8–82

Cytochrome b559 subunit beta

OrganismNot specified

UniProt Q08363

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–31； UniProt 14–44 Author chain f； PDBConstruct 1–31； UniProt 14–44

PDZ domain-containing protein

Chlamydomonas reinhardtii

UniProt A0A2K3E6S5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3E6S5_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–240； UniProt 86–325 Author chain g； PDBConstruct 1–240； UniProt 86–325

Photosystem II reaction center protein H

OrganismNot specified

UniProt P22666

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–69； UniProt 17–85 Author chain h； PDBConstruct 1–69； UniProt 17–85

Photosystem II reaction center protein I

OrganismNot specified

UniProt P59763

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–34； UniProt 1–34 Author chain i； PDBConstruct 1–34； UniProt 1–34

Photosystem II reaction center protein K

OrganismNot specified

UniProt P18263

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–37； UniProt 10–46 Author chain k； PDBConstruct 1–37； UniProt 10–46

Photosystem II reaction center protein L

OrganismNot specified

UniProt P32974

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–38； UniProt 1–38 Author chain l； PDBConstruct 1–38； UniProt 1–38

Photosystem II reaction center protein M

OrganismNot specified

UniProt P92277

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–27； UniProt 4–30 Author chain m； PDBConstruct 1–27； UniProt 4–30

Photosystem II reaction center protein T

OrganismNot specified

UniProt P37256

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain T； PDBConstruct 1–31； UniProt 1–31 Author chain t； PDBConstruct 1–31； UniProt 1–31

Photosystem II reaction center protein Psb30

OrganismNot specified

UniProt P50370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB30_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain V； PDBConstruct 1–31； UniProt 3–33 Author chain v； PDBConstruct 1–31； UniProt 3–33

Photosystem II reaction center W protein, chloroplastic

OrganismNot specified

UniProt Q9SPI9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Chloroplast photosystem II subunit X × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBW_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain W； PDBConstruct 1–19； UniProt 79–97 Author chain w； PDBConstruct 1–19； UniProt 79–97

Chloroplast photosystem II subunit X

OrganismNot specified

UniProt A8I846

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Photosystem II reaction center protein Z × 2 （P92276） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8I846_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain X； PDBConstruct 1–32； UniProt 64–95 Author chain x； PDBConstruct 1–32； UniProt 64–95

Photosystem II reaction center protein Z

OrganismNot specified

UniProt P92276

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） PDZ domain-containing protein × 2 （A0A2K3E6S5） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Psb30 × 2 （P50370） Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Chloroplast photosystem II subunit X × 2 （A8I846） FE (II) ION × 2 CHLOROPHYLL A × 70 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 6 DODECYL-ALPHA-D-MALTOSIDE × 2 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain Z； PDBConstruct 1–61； UniProt 1–61 Author chain z； PDBConstruct 1–61； UniProt 1–61

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9imn
Deposition date deposition_date	2024-07-03
Structure title title	Cryo-EM structure of a TEF30-associated intermediate PSII core dimer complex, type I, from Chlamydomonas reinhardtii
Keywords keywords	photosystem II, PSII repair, PSII assembly, PSII intermediate, TEF30, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9imn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9imn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9imn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.33 Å
Rg (electron density)	54.48 Å
Total Rg	54.75 Å
Atom count	42392
Residues	4462
Excluded volume	787540 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9imn__assembly_1__model_1`	34-meric （34）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Description description	Photosystem II protein D1
Molecular weight formula_weight	36263.3 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	42392

NSSLWARFCEWITSTENRLYIGWFGVIMIPCLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFLLGVYCYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGLSTMAFNLNGFNFNQSVVDSQGRVLNTWADIINRANLGMEVMHERNA

Entity 2 Entity 2 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	52938.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

GLPWYRVHTVVINDPGRLISVHLMHTALVSGWAGSMALFEISVFDPSDPVLNPMWRQGMFVLPFMTRLGITQSWGGWTISGETATNPGIWSYEGVAAAHIILSGALFLASVWHWTYWDLELFRDPRTGKTALDLPKIFGIHLFLSGLLCFGFGAFHVTGVFGPGIWVSDPYGLTGRVQPVAPSWGADGFDPYNPGGIASHHIAAGILGVLAGLFHLCVRPSIRLYFGLSMGSIETVLSSSIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIQKRVQASLAEGASLSDAWSRIPEKLAFYDYIGNNPAKGGLFRTGAMNSGDGIAVGWLGHASFKDQEGRELFVRRMPTFFETFPVLLLDKDGIVRADVPFRKAESKYSIEQVGVSVTFYGGELDGLTFTDPATVKKYARKAQLGEIFEFDRSTLQSDGVFRSSPRGWFTFGHVCFALLFFFGHIWHGARTIFRDVFAG

Entity 3 Entity 3 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	49473.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

GGRDQETTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVSHFVPEKPMYEQGLILLPHIATLGYGVGPGGEIIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESYPFFGYVWKDKNKMTNILGYHLIMLGLGAWLLVWKAMYFGGVYDTWAPGGGDVRVITNPTTNAAVIFGYLVKSPFGGDGWICSVDNMEDIIGGHIWIGTLEILGGIWHIYTTPWPWARRAFVWSGEAYLSYSLGAIGVMGFIACCMSWFNNTAYPSEFYGPTGPEASQSQAFTFLVRDQRLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKLKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLACSHFCLGFFFFIGHLWHAGRARAAAAGFEKGIDRFDEPVLSMRPLD

Entity 4 Entity 4 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39342.8 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

TIAIGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWYTHGLATSYLEGCNFLTAAVSTPANSMAHSLLFVWGPEAQGDFTRWCQLGGLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL

Entity 5 Entity 5 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	8598.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

RPFSDILTSIRYWVIHSITVPALFIAGWLFVSTGLAYDVFGTPRPNEYFTEDRQEAPLITDRFNALEQVKKLSGN

Entity 6 Entity 6 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	3535.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

IFTVRWLAIHGIAVPTIFFLGAITAMQFIQR

Entity 7 Entity 7 polymer

Description description	PDZ domain-containing protein
Molecular weight formula_weight	27116.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,g

ARGNDGGAYIIEVNPKAGNIDARVQPGDKIVEISASFGSEVWKAENFGQIMYAIRTRSGTVYMKLKKNYGDLSALEEEGLDAAEKQWKKERAGGNYGAGTKEIQARNYVQRKENERKRREMFDDALAKFKENDIQGALVEFENIIAMEPRNFVGDNFSRNTPIYKVTQYNIACCYSMLDQVEEAIKSLDAAMLSGFDNYDQIRRDKNLSKARANPKFQAVLDKYDEPVVNWNAVKATFGA

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	7522.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

FQEPGLVTPLGTLLRPLNSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLILDDVSMSWETLA

Entity 9 Entity 9 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	3902.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MLTLKIFVYTVVTFFVCLFIFGFLSNDPARNPGK

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	4148.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

KLPEAYAPFAPIVDVLPVIPVFFILLAFVWQAAVSFR

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4431.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MARPNPNKQVVELNRTSLYWGLLLIFVLAVLFSSYIFN

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	2971.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

NIYGLTATALFIIIPTSFLLILYVKTA

Entity 13 Entity 13 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3639.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

MEALVYTFLLVGTLGIIFFSIFFRDPPRMIK

Entity 14 Entity 14 polymer

Description description	Photosystem II reaction center protein Psb30
Molecular weight formula_weight	3087.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,v

IELALTLVSLVLVVSAGPLVVVLLSARGGNL

Entity 15 Entity 15 polymer

Description description	Photosystem II reaction center W protein, chloroplastic
Molecular weight formula_weight	2192.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,w

PVLGWVLLGVFGTMWAIWF

Entity 16 Entity 16 polymer

Description description	Chloroplast photosystem II subunit X
Molecular weight formula_weight	3056.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

AVTPSLKNFLGSLIAGATVLGGIALAITAVSK

Entity 17 Entity 17 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6466.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MTSILQVALLALIFVSFALVVGVPVVFATPNGWTDNKGAVFSGLSLWLLLVFVVGILNSFV

Entity 18 Entity 18 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	70

Entity 20 Entity 20 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 21 Entity 21 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 22 Entity 22 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 23 Entity 23 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 24 Entity 24 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 25 Entity 25 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 26 Entity 26 non-polymer

Description description	DODECYL-ALPHA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 29 Entity 29 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.97 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	61267

Cryo-EM structure of a TEF30-associated intermediate PSII core dimer complex, type I, from Chlamydomonas reinhardtii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PDZ domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer