7eqg

Structure of Csy-AcrIF5

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR type I-F/YPEST-associated protein Csy2

Pseudomonas aeruginosa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 14 DNA 2 RNA 1	CRISPR-associated protein Csy3 × 6 （A0A659BSG0） AcrIF5 × 5 （A0A7M3A7R4） type I-F CRISPR-associated endoribonuclease Cas6/Csy4 × 1 RNA (60-MER) × 1 DNA (54-MER) × 1 Type I-F CRISPR-associated protein Csy1 × 1 （A0A3A8DDU9） DNA (54-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B3G161_PSEAI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–327； UniProt 1–327

CRISPR-associated protein Csy3

Pseudomonas aeruginosa

UniProt A0A659BSG0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 14 DNA 2 RNA 1	CRISPR type I-F/YPEST-associated protein Csy2 × 1 （B3G161） AcrIF5 × 5 （A0A7M3A7R4） type I-F CRISPR-associated endoribonuclease Cas6/Csy4 × 1 RNA (60-MER) × 1 DNA (54-MER) × 1 Type I-F CRISPR-associated protein Csy1 × 1 （A0A3A8DDU9） DNA (54-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A659BSG0_PSEAI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–342； UniProt 1–342 Author chain E； PDBConstruct 1–342； UniProt 1–342 Author chain F； PDBConstruct 1–342； UniProt 1–342 Author chain G； PDBConstruct 1–342； UniProt 1–342 Author chain H； PDBConstruct 1–342； UniProt 1–342 Author chain I； PDBConstruct 1–342； UniProt 1–342

AcrIF5

Pseudomonas aeruginosa

UniProt A0A7M3A7R4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 14 DNA 2 RNA 1	CRISPR type I-F/YPEST-associated protein Csy2 × 1 （B3G161） CRISPR-associated protein Csy3 × 6 （A0A659BSG0） type I-F CRISPR-associated endoribonuclease Cas6/Csy4 × 1 RNA (60-MER) × 1 DNA (54-MER) × 1 Type I-F CRISPR-associated protein Csy1 × 1 （A0A3A8DDU9） DNA (54-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7M3A7R4_PSEAI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–79； UniProt 1–79 Author chain K； PDBConstruct 1–79； UniProt 1–79 Author chain P； PDBConstruct 1–79； UniProt 1–79 Author chain Q； PDBConstruct 1–79； UniProt 1–79 Author chain R； PDBConstruct 1–79； UniProt 1–79

Type I-F CRISPR-associated protein Csy1

Pseudomonas aeruginosa

UniProt A0A3A8DDU9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 14 DNA 2 RNA 1	CRISPR type I-F/YPEST-associated protein Csy2 × 1 （B3G161） CRISPR-associated protein Csy3 × 6 （A0A659BSG0） AcrIF5 × 5 （A0A7M3A7R4） type I-F CRISPR-associated endoribonuclease Cas6/Csy4 × 1 RNA (60-MER) × 1 DNA (54-MER) × 1 DNA (54-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3A8DDU9_PSEAI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain B； PDBConstruct 1–434； UniProt 1–434

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7eqg
Deposition date deposition_date	2021-05-01
Structure title title	Structure of Csy-AcrIF5
Keywords keywords	complex, inhibitor, IMMUNE SYSTEM, IMMUNE SYSTEM-RNA-DNA complex; IMMUNE SYSTEM/RNA/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7eqg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7eqg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7eqg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.69 Å
Rg (electron density)	55.36 Å
Total Rg	55.37 Å
Atom count	26301
Residues	3249
Excluded volume	455370 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7eqg__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	CRISPR type I-F/YPEST-associated protein Csy2
Molecular weight formula_weight	36244.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	26301

MSVTDPEALLLLPRLSIQNANAISSPLTWGFPSPGAFTGFVHALQRRVGISLDIELDGVGIVCHRFEAQISQPAGKRTKVFNLTRNPLNRDGSTAAIVEEGRAHLEVSLLLGVHGDGLDDHPAQEIARQVQEQAGAMRLAGGSILPWCNERFPAPNAELLMLGGSDEQRRKNQRRLTRRLLPGFALVSREALLQQHLETLRTTLPEATTLDALLDLCRINFEPPATSSEEEASPPDAAWQVRDKPGWLVPIPAGYNALSPLYLPGEVRNARDRETPLRFVENLFGLGEWLSPHRVAALSDLLWYHHAEPDKGLYRWSTPRFVEHAIA

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	CRISPR-associated protein Csy3
Molecular weight formula_weight	37623.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F,G,H,I

MSKPILSTASVLAFERKLDPSDALMSAGAWAQRDASQEWPAVTVREKSVRGTISNRLKTKDRDPAKLDASIQSPNLQTVDVANLPSDADTLKVRFTLRVLGGAGTPSACNDAAYRDKLLQTVATYVNEQGFAELARRYAHNLANARFLWRNRVGAEAVEVRINHIRQGEVARTWRFDALAIGLRDFKADAELDALAELIASGLSGSGHVLLEVVAFARIGDGQEVFPSQELILDKGDKKGQKSKTLYSVRDAAAIHSQKIGNALRTIDTWYPDEDGLGPIAVEPYGSVTSQGKAYRQPKQKLDFYTLLDNWVLRDEAPAVEQQHYVIANLIRGGVFGEAEEK

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	AcrIF5
Molecular weight formula_weight	8531.9 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K,P,Q,R

MSRPTVVTVTETPRNPGSYEVNVERDGKMVVGRARAGSDPGAAAAKAMQMAMEWGSPNYVILGSNKVLAFIPEQLRVKM

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	type I-F CRISPR-associated endoribonuclease Cas6/Csy4
Molecular weight formula_weight	21429.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARTLDLPFVTLRSQSTGQHFRLFIRHGPLQATAEEGGFTCYGLSKGGFVPWF

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	RNA (60-MER)
Molecular weight formula_weight	19265.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	M

CUAAGAAAUUCACGGCGGGCUUGAUGUCCGCGUCUACCUGGUUCACUGCCGUGUAGGCAG

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	DNA (54-MER)
Molecular weight formula_weight	16708.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

GGAAGCCATCCAGGTAGACGCGGACATCAAGCCCGCCGTGAAGGTGCAGCTGCT

Entity 7 Entity 7 polymer

Description description	Type I-F CRISPR-associated protein Csy1
Molecular weight formula_weight	49313.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTSPLPTPTWQELRQFIESFIQERLQGKLDKLHPDEDDKRQTLLATHRREAWLADAARRVGQLQLVTHTLKPIHPDARGSNLHSLPQAPGQPGLAGSHELGDRLVSDVVGNAAALDVFKFLSLQYQGKNLLNWLTEDSAEAVQALSDNAEQAREWRQAFIGITAVKGAPASHSLAKQLYFPLPGSGYHLLAPLFPTSLVHHVHALLREARFGDAAKAAREARSRQESWPHGFSEYPNLAIQKFGGTKPQNISQLNSERYGENWLLPSLPPHWQRQDQRAPIRHSSVFEHDFGRSPEVSRLTRTLQRLLAKTRHNNFTIRRYRAQLVGQICDEALQYAARLRELEPGWSATPGCQLHDAEQLWLDPLRAQTDETFLQRRLRGDWPAEVGNRFANWLNRAVSSDSQILGSPEAAQWSQELSKELTMFKEILEDERD

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	DNA (54-MER)
Molecular weight formula_weight	16574.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	O

AGCAGCTGCACCTTCACGGCGGGCTTGATGTCCGCGTCTACCTGGATGGCTTCC

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	173096

Structure of Csy-AcrIF5

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR type I-F/YPEST-associated protein Csy2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated protein Csy3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AcrIF5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type I-F CRISPR-associated protein Csy1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7eqg__assembly_1__model_1

7eqg__assembly_1__model_1 | I(q)

7eqg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Source Source

Entity 8 Entity 8 polymer

Polymer Polymer

7. Citations (1)