SAXSdb — 7jzw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR type I-F/YPEST-associated protein Csy1

Pseudomonas aeruginosa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） CRISPR type I-F/YPEST-associated protein Csy2 × 1 （B3G161） CRISPR type I-F/YPEST-associated protein Csy3 × 6 （A0A444M080） Type I-F anti-CRISPR protein × 1 （A0A076FR21） CRISPR repeat sequence × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A643HYU6_PSEAI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–434； UniProt 1–434

CRISPR-associated endonuclease Cas6/Csy4

Pseudomonas aeruginosa

UniProt Q02MM2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	CRISPR type I-F/YPEST-associated protein Csy1 × 1 （A0A643HYU6） CRISPR type I-F/YPEST-associated protein Csy2 × 1 （B3G161） CRISPR type I-F/YPEST-associated protein Csy3 × 6 （A0A444M080） Type I-F anti-CRISPR protein × 1 （A0A076FR21） CRISPR repeat sequence × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAS6_PSEAB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–187； UniProt 1–187

CRISPR type I-F/YPEST-associated protein Csy2

Pseudomonas aeruginosa

UniProt B3G161

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	CRISPR type I-F/YPEST-associated protein Csy1 × 1 （A0A643HYU6） CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） CRISPR type I-F/YPEST-associated protein Csy3 × 6 （A0A444M080） Type I-F anti-CRISPR protein × 1 （A0A076FR21） CRISPR repeat sequence × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B3G161_PSEAI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 3–329； UniProt 1–327

CRISPR type I-F/YPEST-associated protein Csy3

Pseudomonas aeruginosa

UniProt A0A444M080

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	CRISPR type I-F/YPEST-associated protein Csy1 × 1 （A0A643HYU6） CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） CRISPR type I-F/YPEST-associated protein Csy2 × 1 （B3G161） Type I-F anti-CRISPR protein × 1 （A0A076FR21） CRISPR repeat sequence × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A444M080_PSEAI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 3–344； UniProt 1–342 Author chain E； PDBConstruct 3–344； UniProt 1–342 Author chain F； PDBConstruct 3–344； UniProt 1–342 Author chain G； PDBConstruct 3–344； UniProt 1–342 Author chain H； PDBConstruct 3–344； UniProt 1–342 Author chain I； PDBConstruct 3–344； UniProt 1–342

Type I-F anti-CRISPR protein

Pseudomonas phage sp.

UniProt A0A076FR21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	CRISPR type I-F/YPEST-associated protein Csy1 × 1 （A0A643HYU6） CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） CRISPR type I-F/YPEST-associated protein Csy2 × 1 （B3G161） CRISPR type I-F/YPEST-associated protein Csy3 × 6 （A0A444M080） CRISPR repeat sequence × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A076FR21_BPD31
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain J； PDBConstruct 1–100； UniProt 1–100

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7jzw
Deposition date deposition_date	2020-09-02
Structure title title	Cryo-EM structure of CRISPR-Cas surveillance complex with AcrIF4
Keywords keywords	CRISPR, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7jzw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7jzw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7jzw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.21 Å
Rg (electron density)	48.75 Å
Total Rg	48.89 Å
Atom count	24263
Residues	3047
Excluded volume	423620 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7jzw__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	CRISPR type I-F/YPEST-associated protein Csy1
Molecular weight formula_weight	49136.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	24266

MTSPLPTPTWQELRQFIESFIQERLQGKLDKLQPDEDDKRQTLLATHRREAWLADAARRVGQLQLVTHTLKPIHPDARGSNLHSLPQAPGQPGLAGSHELGDRLVSDVVGNAAALDVFKFLSLQYQGKNLLNWLTEDSAEALQALSDNAEQAREWRQAFIGITTVKGAPASHSLAKQLYFPLPGSGYHLLAPLFPTSLVHHVHALLREARFGDAAKAAREARSRQESWPHGFSEYPNLAIQKFGGTKPQNISQLNNERRGENWLLPSLPPNWQRQNVNAPMRHSSVFAHDFGRTPEVSRLTRTLQRFLAKTVHNNLAIRQRRAQLVAQICDEALQYAARLRELEPGWSATPGCQLHDAEQLWLDPLRAQTDETFLQRRLRGDWPAEVGNRFANWLNRAVSSDSQILGSPEAAQWSQELSKELTMFKEILEDERD

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	CRISPR-associated endonuclease Cas6/Csy4
Molecular weight formula_weight	21427.5 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	CRISPR type I-F/YPEST-associated protein Csy2
Molecular weight formula_weight	36446.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAMSVTDPEALLLLPRLSIQNANAISSPLTWGFPSPGAFTGFVHALQRRVGISLDIELDGVGIVCHRFEAQISQPAGKRTKVFNLTRNPLNRDGSTAAIVEEGRAHLEVSLLLGVHGDGLDDHPAQEIARQVQEQAGAMRLAGGSILPWCNERFPAPNAELLMLGGSDEQRRKNQRRLTRRLLPGFALVSREALLQQHLETLRTTLPEATTLDALLDLCRINFEPPATSSEEEASPPDAAWQVRDKPGWLVPIPAGYNALSPLYLPGEVRNARDRETPLRFVENLFGLGEWLSPHRVAALSDLLWYHHAEPDKGLYRWSTPRFVEHAIA

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	CRISPR type I-F/YPEST-associated protein Csy3
Molecular weight formula_weight	37781.5 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,D,F,G,H,I

MAMSKPILSTASVLAFERKLDPSDALMSAGAWAQRDASQEWPAVTVREKSVRGTISNRLKTKDRDPAKLDASIQSPNLQTVDVANLPSDADTLKVRFTLRVLGGAGTPSACNDAAYRDKLLQTVATYVNDQGFAELARRYAHNLANARFLWRNRVGAEAVEVRINHIRQGEVARAWRFDALAIGLRDFKADAELDALAELIASGLSGSGHVLLEVVAFARIGDGQEVFPSQELILDKGDKKGQKSKTLYSVRDAAAIHSQKIGNALRTIDTWYPDEDGLGPIAVEPYGSVTSQGKAYRQPKQKLDFYTLLDNWVLRDEAPAVEQQHYVIANLIRGGVFGEAEEK

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 polymer

Description description	Type I-F anti-CRISPR protein
Molecular weight formula_weight	11087.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MMTISKTDIDCYLQTYVVIDPVSNGWQWGIDENGVGGALHHGRVEMVEGENGYFGLRGATHPTEKEAMAAALGYLWKCRQDLVAIARNDAIEAEKYRAKA

Source Source

Source organism organism	Pseudomonas phage sp.
NCBI taxonomy ID ncbi_taxonomy_id	2729638
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 6 Entity 6 polymer

Description description	CRISPR repeat sequence
Molecular weight formula_weight	19538.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	M

CUAAGAAAUUCACGGCGGGCUUGAUGUCCGCGUCUACCUGAUUCACUGCCGUAUAGGCAGC

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli BL21(DE3)

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	7jzwC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	2540 — CRISPR-associated endoribonuclease Cas6/Csy4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	766782

Cryo-EM structure of CRISPR-Cas surveillance complex with AcrIF4

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR type I-F/YPEST-associated protein Csy1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated endonuclease Cas6/Csy4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR type I-F/YPEST-associated protein Csy2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR type I-F/YPEST-associated protein Csy3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type I-F anti-CRISPR protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7jzw__assembly_1__model_1

7jzw__assembly_1__model_1 | I(q)

7jzw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)