SAXSdb — 7fff

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein

Venezuelan equine encephalitis virus (strain TC-83)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Low-density lipoprotein receptor class A domain-containing protein 3 × 4 （Q86YD5） CALCIUM ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLS_EEVV8
Isoform	—
PDB entities	1, 2, 4, 5
Chains and sequence ranges	Author chain A； PDBConstruct 1–275； UniProt 1–275 Author chain F； PDBConstruct 1–275； UniProt 1–275 Author chain K； PDBConstruct 1–275； UniProt 1–275 Author chain S； PDBConstruct 1–275； UniProt 1–275 Author chain B； PDBConstruct 1–442； UniProt 813–1254 Author chain C； PDBConstruct 1–442； UniProt 813–1254 Author chain G； PDBConstruct 1–442； UniProt 813–1254 Author chain O； PDBConstruct 1–442； UniProt 813–1254 Author chain I； PDBConstruct 1–59； UniProt 276–334 Author chain L； PDBConstruct 1–59； UniProt 276–334 Author chain P； PDBConstruct 1–59； UniProt 276–334 Author chain T； PDBConstruct 1–59； UniProt 276–334 Author chain J； PDBConstruct 1–423； UniProt 335–757 Author chain N； PDBConstruct 1–423； UniProt 335–757 Author chain Q； PDBConstruct 1–423； UniProt 335–757 Author chain R； PDBConstruct 1–423； UniProt 335–757

Low-density lipoprotein receptor class A domain-containing protein 3

Homo sapiens

UniProt Q86YD5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Capsid protein × 4 （P05674） Spike glycoprotein E1 × 4 （P05674） assembly protein E3 × 4 （P05674） Spike glycoprotein E2 × 4 （P05674） CALCIUM ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LRAD3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–70； UniProt 1–70 Author chain E； PDBConstruct 1–70； UniProt 1–70 Author chain H； PDBConstruct 1–70； UniProt 1–70 Author chain M； PDBConstruct 1–70； UniProt 1–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7fff
Deposition date deposition_date	2021-07-23
Structure title title	Structure of Venezuelan equine encephalitis virus with the receptor LDLRAD3
Keywords keywords	Virus, Receptor, Complex, VIRUS LIKE PARTICLE, VIRUS LIKE PARTICLE-PROTEIN BINDING complex; VIRUS LIKE PARTICLE/PROTEIN BINDING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7fff__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7fff__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7fff__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	67.37 Å
Rg (electron density)	66.98 Å
Total Rg	67.32 Å
Atom count	34356
Residues	4448
Excluded volume	610350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7fff__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Capsid protein
Molecular weight formula_weight	30980.8 kDa
EC 编号 ec_number	3.4.21.90
Mutation mutation	K64N
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,S,A,F
Atom count atom_count	34356

MFPFQPMYPMQPMPYRNPFAAPRRPWFPRTDPFLAMQVQELTRSMANLTFKQRRDAPPEGPSANKPKKEASQKQKGGGQGKKKKNQGKKKAKTGPPNPKAQNGNKKKTNKKPGKRQRMVMKLESDKTFPIMLEGKINGYACVVGGKLFRPMHVEGKIDNDVLAALKTKKASKYDLEYADVPQNMRADTFKYTHEKPQGYYSWHHGAVQYENGRFTVPKGVGAKGDSGRPILDNQGRVVAIVLGGVNEGSRTALSVVMWNEKGVTVKYTPENCEQW

Source Source

Source organism organism	Venezuelan equine encephalitis virus (strain TC-83)
Common name common_name	VEEV
NCBI taxonomy ID ncbi_taxonomy_id	11037
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Spike glycoprotein E1
Molecular weight formula_weight	47952.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,B,C,O

YEHATTMPSQAGISYNTIVNRAGYAPLPISITPTKIKLIPTVNLEYVTCHYKTGMDSPAIKCCGSQECTPTYRPDEQCKVFTGVYPFMWGGAYCFCDTENTQVSKAYVMKSDDCLADHAEAYKAHTASVQAFLNITVGEHSIVTTVYVNGETPVNFNGVKITAGPLSTAWTPFDRKIVQYAGEIYNYDFPEYGAGQPGAFGDIQSRTVSSSDLYANTNLVLQRPKAGAIHVPYTQAPSGFEQWKKDKAPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFTRVSETPTLSAAECTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEAAVELTEQGSATIHFSTANIHPEFRLQICTSYVTCKGDCHPPKDHIVTHPQYHAQTFTAAVSKTAWTWLTSLLGGSAVIIIIGLVLATIVAMYVLTNQKHN

Source Source

Source organism organism	Venezuelan equine encephalitis virus (strain TC-83)
Common name common_name	VEEV
NCBI taxonomy ID ncbi_taxonomy_id	11037
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Low-density lipoprotein receptor class A domain-containing protein 3
Molecular weight formula_weight	7614.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,D,E,M

MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	assembly protein E3
Molecular weight formula_weight	6488.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,T,P,L

SLVTTMCLLANVTFPCAQPPICYDRKPAETLAMLSVNVDNPGYDELLEAAVKCPGRKRR

Source Source

Source organism organism	Venezuelan equine encephalitis virus (strain TC-83)
Common name common_name	VEEV
NCBI taxonomy ID ncbi_taxonomy_id	11037
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Spike glycoprotein E2
Molecular weight formula_weight	47113.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,Q,R,N

STEELFNEYKLTRPYMARCIRCAVGSCHSPIAIEAVKSDGHDGYVRLQTSSQYGLDSSGNLKGRTMRYDMHGTIKEIPLHQVSLYTSRPCHIVDGHGYFLLARCPAGDSITMEFKKDSVRHSCSVPYEVKFNPVGRELYTHPPEHGVEQACQVYAHDAQNRGAYVEMHLPGSEVDSSLVSLSGSSVTVTPPDGTSALVECECGGTKISETINKTKQFSQCTKKEQCRAYRLQNDKWVYNSDKLPKAAGATLKGKLHVPFLLADGKCTVPLAPEPMITFGFRSVSLKLHPKNPTYLITRQLADEPHYTHELISEPAVRNFTVTEKGWEFVWGNHPPKRFWAQETAPGNPHGLPHEVITHYYHRYPMSTILGLSICAAIATVSVAASTWLFCRSRVACLTPYRLTPNARIPFCLAVLCCARTARA

Source Source

Source organism organism	Venezuelan equine encephalitis virus (strain TC-83)
Common name common_name	VEEV
NCBI taxonomy ID ncbi_taxonomy_id	11037
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	726076

Structure of Venezuelan equine encephalitis virus with the receptor LDLRAD3

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Low-density lipoprotein receptor class A domain-containing protein 3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7fff__assembly_1__model_1

7fff__assembly_1__model_1 | I(q)

7fff__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 non-polymer

7. Citations (1)

Structure of Venezuelan equine encephalitis virus with the receptor LDLRAD3

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Low-density lipoprotein receptor class A domain-containing protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7fff__assembly_1__model_1

7fff__assembly_1__model_1 | I(q)

7fff__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 non-polymer

7. Citations (1)