SAXSdb — 7fj2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Forkhead box protein M1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Homooligomer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain A； UniProt 222–337 Chain B； UniProt 222–337	Not recorded	;DNA (5'-D(APCPCPGPTPAPAPAPCPAPTPGPTPTPTPAPCPGPGPT)-3') ; × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 4.7；277 K；50 mM Sodium acetate pH 4.7 250 mM Sodium chloride 15% PEG 3350	Resolution 3.10 Å R-free 0.265
2	Protein–DNA Homooligomer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain E； UniProt 222–337 Chain F； UniProt 222–337	Not recorded	;DNA (5'-D(APCPCPGPTPAPAPAPCPAPTPGPTPTPTPAPCPGPGPT)-3') ; × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 4.7；277 K；50 mM Sodium acetate pH 4.7 250 mM Sodium chloride 15% PEG 3350	Resolution 3.10 Å R-free 0.265

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7FJ2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3G73 Structure of the FOXM1 DNA binding Deposited 2009-02-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 222–360（139 aa） Fragment：DNA-binding domain, UNP residues 222-360 Chain B 222–360（139 aa） Fragment：DNA-binding domain, UNP residues 222-360	Not recorded	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；24% PEG3350, 0.2M Sodium Malonate, pH7.5, 3uL Protein at 12g/L mixed with DNA at 0.5mM added tO 3uL of reservoir, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.21 Å R-free 0.234
9XS1 Crystal structure of FOXM1 DNA binding domain to specific dsDNA substrate Deposited 2025-11-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 223–360（138 aa） Fragment：DNA binding domain Chain G 223–360（138 aa） Fragment：DNA binding domain	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；10% PEG 20000, 0.1 M Sodium citrate tribasic dihydrate (pH 5.0) and 0.2 M Magnesium chloride hexahydrate	Resolution 2.50 Å R-free 0.249
9XS1 Crystal structure of FOXM1 DNA binding domain to specific dsDNA substrate Deposited 2025-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain D 223–360（138 aa） Fragment：DNA binding domain	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；10% PEG 20000, 0.1 M Sodium citrate tribasic dihydrate (pH 5.0) and 0.2 M Magnesium chloride hexahydrate	Resolution 2.50 Å R-free 0.249

2 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FOXM1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–117； UniProt 222–337 Author chain B； PDBConstruct 2–117； UniProt 222–337 Author chain E； PDBConstruct 2–117； UniProt 222–337 Author chain F； PDBConstruct 2–117； UniProt 222–337

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7fj2
Deposition date deposition_date	2021-08-02
Structure title title	Structure of FOXM1 homodimer bound to a palindromic DNA site
Keywords keywords	Forkhead transcription factors, FOXM1, Dimer, DNA binding, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	31.84 Å
Radius of gyration Rg (electron density) rg_electron	31.49 Å
Forward intensity I(0) i0	90618100.00
Molecular weight molecular_weight	60583.0 kDa
Excluded volume excluded_volume	69061 Å³
Envelope volume envelope_volume	101440 Å³
Hydration-shell volume shell_volume	27084 Å³
Envelope diameter envelope_diameter	101.9 Å
Shell Rg shell_rg	38.41 Å
Envelope Rg envelope_rg	30.42 Å
Shape Rg shape_rg	31.48 Å
Total Rg total_rg	32.01 Å
Total atoms total_atoms	4180
Residues n_residues	394
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	100.7 Å
Rg (real space) rg_real	31.83 Å
Rg uncertainty (real space) rg_real_error	1.10 Å
I(0) (real space) i0_real	9.0620e+07
I(0) uncertainty (real space) i0_real_error	1.4260e+06
Rg (reciprocal space) rg_reciprocal	31.84 Å
I(0) (reciprocal space) i0_reciprocal	90620000.0000
Solution quality estimate total_estimate	0.8873
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	50.3 Å
Skewness Skewness skewness	0.129
Kurtosis Kurtosis kurtosis	-0.836
Angular range angular_range	— – 0.2500 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	7402000.0000
Real-space data points n_real_points	51
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.892; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.926; Smooth: 0.929

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Forkhead box protein M1
Molecular weight formula_weight	13680.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,F
Atom count atom_count	4180

GPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(APCPCPGPTPAPAPAPCPAPTPGPTPTPTPAPCPGPGPT)-3') ;
Molecular weight formula_weight	6133.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C,D,G,H

ACCGTAAACATGTTTACGGT

来源 Source

来源生物 organism	Homo sapiens
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

▶

8. Citations (1)

▶

Unit-cell length a length_a	69.387 Å
Unit-cell length b length_b	45.456 Å
Unit-cell length c length_c	133.591 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.85 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.098 Å
Low-resolution limit resolution_low	49.303 Å
R factor r_factor	0.2208
R_work r_work	0.2160
R_free r_free	0.2654

fit	/app/data/saxs_computation/fj/7fj2/7fj2.fit
pddf	/app/data/pr_computation/fj/7fj2/7fj2.pr.out
profile	/app/data/saxs_computation/fj/7fj2/7fj2.dat

Structure of FOXM1 homodimer bound to a palindromic DNA site

1. Protein Identity and Related Structures Protein Identity & Related Structures

Forkhead box protein M1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)