7nyh

Respiratory complex I from Escherichia coli - focused refinement of membrane arm

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-quinone oxidoreductase subunit A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit H × 1 （P0AFD4） NADH-quinone oxidoreductase subunit J × 1 （P0AFE0） NADH-quinone oxidoreductase subunit K × 1 （F4VE45） NADH-quinone oxidoreductase subunit L × 1 （A0A1V3W1N5） NADH-quinone oxidoreductase subunit M × 1 （P0AFE8） NADH-quinone oxidoreductase subunit N × 1 （P0AFF0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOA_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–147； UniProt 1–147

NADH-quinone oxidoreductase subunit H

OrganismNot specified

UniProt P0AFD4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit J × 1 （P0AFE0） NADH-quinone oxidoreductase subunit K × 1 （F4VE45） NADH-quinone oxidoreductase subunit L × 1 （A0A1V3W1N5） NADH-quinone oxidoreductase subunit M × 1 （P0AFE8） NADH-quinone oxidoreductase subunit N × 1 （P0AFF0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOH_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–325； UniProt 1–325

NADH-quinone oxidoreductase subunit J

OrganismNot specified

UniProt P0AFE0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 1 （P0AFD4） NADH-quinone oxidoreductase subunit K × 1 （F4VE45） NADH-quinone oxidoreductase subunit L × 1 （A0A1V3W1N5） NADH-quinone oxidoreductase subunit M × 1 （P0AFE8） NADH-quinone oxidoreductase subunit N × 1 （P0AFF0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOJ_ECOLI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–184； UniProt 1–184

NADH-quinone oxidoreductase subunit K

OrganismNot specified

UniProt F4VE45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 1 （P0AFD4） NADH-quinone oxidoreductase subunit J × 1 （P0AFE0） NADH-quinone oxidoreductase subunit L × 1 （A0A1V3W1N5） NADH-quinone oxidoreductase subunit M × 1 （P0AFE8） NADH-quinone oxidoreductase subunit N × 1 （P0AFF0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F4VE45_ECOLX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–100； UniProt 1–100

NADH-quinone oxidoreductase subunit L

OrganismNot specified

UniProt A0A1V3W1N5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 1 （P0AFD4） NADH-quinone oxidoreductase subunit J × 1 （P0AFE0） NADH-quinone oxidoreductase subunit K × 1 （F4VE45） NADH-quinone oxidoreductase subunit M × 1 （P0AFE8） NADH-quinone oxidoreductase subunit N × 1 （P0AFF0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1V3W1N5_ECOLX
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–613； UniProt 1–613

NADH-quinone oxidoreductase subunit M

OrganismNot specified

UniProt P0AFE8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 1 （P0AFD4） NADH-quinone oxidoreductase subunit J × 1 （P0AFE0） NADH-quinone oxidoreductase subunit K × 1 （F4VE45） NADH-quinone oxidoreductase subunit L × 1 （A0A1V3W1N5） NADH-quinone oxidoreductase subunit N × 1 （P0AFF0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOM_ECOLI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–509； UniProt 1–509

NADH-quinone oxidoreductase subunit N

OrganismNot specified

UniProt P0AFF0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 1 （P0AFD4） NADH-quinone oxidoreductase subunit J × 1 （P0AFE0） NADH-quinone oxidoreductase subunit K × 1 （F4VE45） NADH-quinone oxidoreductase subunit L × 1 （A0A1V3W1N5） NADH-quinone oxidoreductase subunit M × 1 （P0AFE8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUON_ECOLI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain N； PDBConstruct 1–485； UniProt 1–485

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7nyh
Deposition date deposition_date	2021-03-22
Structure title title	Respiratory complex I from Escherichia coli - focused refinement of membrane arm
Keywords keywords	NADH:ubiquinone reductase (H+-translocating), oxidative phosphorylation, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7nyh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7nyh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7nyh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.29 Å
Rg (electron density)	50.79 Å
Total Rg	50.36 Å
Atom count	16167
Residues	2195
Excluded volume	294610 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7nyh__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	NADH-quinone oxidoreductase subunit A
Molecular weight formula_weight	16474.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	16167

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

Entity 2 Entity 2 polymer

Description description	NADH-quinone oxidoreductase subunit H
Molecular weight formula_weight	36240.9 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSWISPELIEILLTILKAVVILLVVVTCGAFMSFGERRLLGLFQNRYGPNRVGWGGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSPGWVVADLNIGILFFLMMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTLSYEVFLGLSLMGVVAQAGSFNMTDIVNSQAHVWNVIPQFFGFITFAIAGVAVCHRHPFDQPEAEQELADGYHIEYSGMKFGLFFVGEYIGIVTISALMVTLFFGGWQGPLLPPFIWFALKTAFFMMMFILIRASLPRPRYDQVMSFGWKICLPLTLINLLVTAAVILWQAQ

Entity 3 Entity 3 polymer

Description description	NADH-quinone oxidoreductase subunit J
Molecular weight formula_weight	19889.6 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIMLVVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVLSNRKDDSAKRKTEEHA

Entity 4 Entity 4 polymer

Description description	NADH-quinone oxidoreductase subunit K
Molecular weight formula_weight	10853.0 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG

Entity 5 Entity 5 polymer

Description description	NADH-quinone oxidoreductase subunit L
Molecular weight formula_weight	66513.6 kDa
EC 编号 ec_number	1.6.5.11,1.6.5.3,1.6.99.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MNMLALTIILPLIGFVLLAFSRGRWSENVSAIVGVGSVGLAALVTAFIGVDFFANGEQTYSQPLWTWMSVGDFNIGFNLVLDGLSLTMLSVVTGVGFLIHMYASWYMRGEEGYSRFFAYTNLFIASMVVLVLADNLLLMYLGWEGVGLCSYLLIGFYYTDPKNGAAAMKAFVVTRVGDVFLAFALFILYNELGTLNFREMVELAPAHFADGNNMLMWATLMLLGGAVGKSAQLPLQTWLADAMAGPTPVSALIHAATMVTAGVYLIARTHGLFLMTPEVLHLVGIVGAVTLLLAGFAALVQTDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAFFKALLFLASGSVILACHHEQNIFKMGGLRKSIPLVYLCFLVGGAALSALPLVTAGFFSKDEILAGAMANGHINLMVAGLVGAFMTSLYTFRMIFIVFHGKEQIHAHAVKGVTHSLPLIVLLILSTFVGALIVPPLQGVLPQTTELAHGSMLTLEITSGVVAVVGILLAAWLWLGKRTLVTSIANSAPGRLLSTWWYNAWGFDWLYDKVFVKPFLGIAWLLKRDPLNSMMNIPAVLSRFAGKGLLLSENGYLRWYVASMSIGAVVVLALLMVLR

Entity 6 Entity 6 polymer

Description description	NADH-quinone oxidoreductase subunit M
Molecular weight formula_weight	56560.1 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MLLPWLILIPFIGGFLCWQTERFGVKVPRWIALITMGLTLALSLQLWLQGGYSLTQSAGIPQWQSEFDMPWIPRFGISIHLAIDGLSLLMVVLTGLLGVLAVLCSWKEIEKYQGFFHLNLMWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASDGKTRITAATKFFIYTQASGLVMLIAILALVFVHYNATGVWTFNYEELLNTPMSSGVEYLLMLGFFIAFAVKMPVVPLHGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPNASAEFAPIAMWLGVIGIFYGAWMAFAQTDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQGAVIQMIAHGLSAAGLFILCGQLYERIHTRDMRMMGGLWSKMKWLPALSLFFAVATLGMPGTGNFVGEFMILFGSFQVVPVITVISTFGLVFASVYSLAMLHRAYFGKAKSQIASQELPGMSLRELFMILLLVVLLVLLGFYPQPILDTSHSAIGNIQQWFVNSVTTTRP

Entity 7 Entity 7 polymer

Description description	NADH-quinone oxidoreductase subunit N
Molecular weight formula_weight	52072.7 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MTITPQNLIALLPLLIVGLTVVVVMLSIAWRRNHFLNATLSVIGLNAALVSLWFVGQAGAMDVTPLMRVDGFAMLYTGLVLLASLATCTFAYPWLEGYNDNKDEFYLLVLIAALGGILLANANHLASLFLGIELISLPLFGLVGYAFRQKRSLEASIKYTILSAAASSFLLFGMALVYAQSGDLSFVALGKNLGDGMLNEPLLLAGFGLMIVGLGFKLSLVPFHLWTPDVYQGAPAPVSTFLATASKIAIFGVVMRLFLYAPVGDSEAIRVVLAIIAFASIIFGNLMALSQTNIKRLLGYSSISHLGYLLVALIALQTGEMSMEAVGVYLAGYLFSSLGAFGVVSLMSSPYRGPDADSLFSYRGLFWHRPILAAVMTVMMLSLAGIPMTLGFIGKFYVLAVGVQAHLWWLVGAVVVGSAIGLYYYLRVAVSLYLHAPEQPGRDAPSNWQYSAGGIVVLISALLVLVLGVWPQPLISIVRLAMPLM

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	37441

Respiratory complex I from Escherichia coli - focused refinement of membrane arm

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-quinone oxidoreductase subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit M

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit N

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7nyh__assembly_1__model_1

7nyh__assembly_1__model_1 | I(q)

7nyh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer