9tal

Local refinement of E. coli Complex I WT hydrophilic domain in LMNG

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-quinone oxidoreductase subunit E

Escherichia coli BW25113

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	NADH-quinone oxidoreductase subunit F × 1 （P31979） NADH-quinone oxidoreductase subunit G × 1 （P33602） NADH-quinone oxidoreductase subunit I × 1 （P0AFD6） NADH-quinone oxidoreductase subunit B × 1 （P0AFC7） NADH-quinone oxidoreductase subunit C/D × 1 （P33599） NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 4 （P0AFD4） FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 7 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOE_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–166； UniProt 1–166

NADH-quinone oxidoreductase subunit F

Escherichia coli BW25113

UniProt P31979

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	NADH-quinone oxidoreductase subunit E × 1 （P0AFD1） NADH-quinone oxidoreductase subunit G × 1 （P33602） NADH-quinone oxidoreductase subunit I × 1 （P0AFD6） NADH-quinone oxidoreductase subunit B × 1 （P0AFC7） NADH-quinone oxidoreductase subunit C/D × 1 （P33599） NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 4 （P0AFD4） FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 7 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOF_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 18–461； UniProt 2–445

NADH-quinone oxidoreductase subunit G

Escherichia coli BW25113

UniProt P33602

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	NADH-quinone oxidoreductase subunit E × 1 （P0AFD1） NADH-quinone oxidoreductase subunit F × 1 （P31979） NADH-quinone oxidoreductase subunit I × 1 （P0AFD6） NADH-quinone oxidoreductase subunit B × 1 （P0AFC7） NADH-quinone oxidoreductase subunit C/D × 1 （P33599） NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 4 （P0AFD4） FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 7 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOG_ECOLI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 3–910； UniProt 1–908

NADH-quinone oxidoreductase subunit I

Escherichia coli BW25113

UniProt P0AFD6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	NADH-quinone oxidoreductase subunit E × 1 （P0AFD1） NADH-quinone oxidoreductase subunit F × 1 （P31979） NADH-quinone oxidoreductase subunit G × 1 （P33602） NADH-quinone oxidoreductase subunit B × 1 （P0AFC7） NADH-quinone oxidoreductase subunit C/D × 1 （P33599） NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 4 （P0AFD4） FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 7 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOI_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–180； UniProt 1–180

NADH-quinone oxidoreductase subunit B

Escherichia coli BW25113

UniProt P0AFC7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	NADH-quinone oxidoreductase subunit E × 1 （P0AFD1） NADH-quinone oxidoreductase subunit F × 1 （P31979） NADH-quinone oxidoreductase subunit G × 1 （P33602） NADH-quinone oxidoreductase subunit I × 1 （P0AFD6） NADH-quinone oxidoreductase subunit C/D × 1 （P33599） NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 4 （P0AFD4） FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 7 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOB_ECOLI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–220； UniProt 1–220

NADH-quinone oxidoreductase subunit C/D

Escherichia coli BW25113

UniProt P33599

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	NADH-quinone oxidoreductase subunit E × 1 （P0AFD1） NADH-quinone oxidoreductase subunit F × 1 （P31979） NADH-quinone oxidoreductase subunit G × 1 （P33602） NADH-quinone oxidoreductase subunit I × 1 （P0AFD6） NADH-quinone oxidoreductase subunit B × 1 （P0AFC7） NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） NADH-quinone oxidoreductase subunit H × 4 （P0AFD4） FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 7 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOCD_ECOLI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 5–600； UniProt 1–596

NADH-quinone oxidoreductase subunit A

Escherichia coli BW25113

UniProt P0AFC3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	NADH-quinone oxidoreductase subunit E × 1 （P0AFD1） NADH-quinone oxidoreductase subunit F × 1 （P31979） NADH-quinone oxidoreductase subunit G × 1 （P33602） NADH-quinone oxidoreductase subunit I × 1 （P0AFD6） NADH-quinone oxidoreductase subunit B × 1 （P0AFC7） NADH-quinone oxidoreductase subunit C/D × 1 （P33599） NADH-quinone oxidoreductase subunit H × 4 （P0AFD4） FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 7 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOA_ECOLI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 1–147； UniProt 1–147

NADH-quinone oxidoreductase subunit H

Escherichia coli BW25113

UniProt P0AFD4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	NADH-quinone oxidoreductase subunit E × 1 （P0AFD1） NADH-quinone oxidoreductase subunit F × 1 （P31979） NADH-quinone oxidoreductase subunit G × 1 （P33602） NADH-quinone oxidoreductase subunit I × 1 （P0AFD6） NADH-quinone oxidoreductase subunit B × 1 （P0AFC7） NADH-quinone oxidoreductase subunit C/D × 1 （P33599） NADH-quinone oxidoreductase subunit A × 1 （P0AFC3） FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 5 FLAVIN MONONUCLEOTIDE × 1 IRON/SULFUR CLUSTER × 7 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUOH_ECOLI
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–325； UniProt 1–325 Author chain J； PDBConstruct 1–325； UniProt 1–325 Author chain K； PDBConstruct 1–325； UniProt 1–325 Author chain L； PDBConstruct 1–325； UniProt 1–325

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9tal
Deposition date deposition_date	2025-11-18
Structure title title	Local refinement of E. coli Complex I WT hydrophilic domain in LMNG
Keywords keywords	PROTON TRANSPORT, bioenergetics; PROTON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9tal__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9tal__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9tal__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.67 Å
Rg (electron density)	45.09 Å
Total Rg	45.02 Å
Atom count	20167
Residues	2552
Excluded volume	358660 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9tal__assembly_1__model_1`	11-meric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	NADH-quinone oxidoreductase subunit E
Molecular weight formula_weight	18614.0 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E
Atom count atom_count	20425

MHENQQPQTEAFELSAAEREAIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIHAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHINGYQGIQAALEKKLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDEDTHAHLTPEAIPELLERYK

Source Source

Source organism organism	Escherichia coli BW25113
NCBI taxonomy ID ncbi_taxonomy_id	679895
Host organism host_organism	Escherichia coli BW25113

Entity 2 Entity 2 polymer

Description description	NADH-quinone oxidoreductase subunit F
Molecular weight formula_weight	51208.4 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MRGSHHHHHHTDPALRAKNIIRTPETHPLTWRLRDDKQPVWLDEYRSKNGYEGARKALTGLSPDEIVNQVKDAGLKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVNLRRAIAEATEAGLLGKNIMGTGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPATSGAWGKPTCVNNVETLCNVPAILANGVEWYQNISKSKDAGTKLMGFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGAGTDFLTEAHLDLPMEFESIGKAGSRLGTALAMAVDHEINMVSLVRNLEEFFARESCGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAHAPGAVEPLQSAIKYFREEFEAGIKQPFSNTHLINGIQPNLLKERW

Source Source

Source organism organism	Escherichia coli BW25113
NCBI taxonomy ID ncbi_taxonomy_id	679895
Host organism host_organism	Escherichia coli BW25113

Entity 3 Entity 3 polymer

Description description	NADH-quinone oxidoreductase subunit G
Molecular weight formula_weight	100663.6 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MLMATIHVDGKEYEVNGADNLLEACLSLGLDIPYFCWHPALGSVGACRQCAVKQYQNAEDTRGRLVMSCMTPASDGTFISIDDEEAKQFRESVVEWLMTNHPHDCPVCEEGGNCHLQDMTVMTGHSFRRYRFTKRTHRNQDLGPFISHEMNRCIACYRCVRYYKDYADGTDLGVYGAHDNVYFGRPEDGTLESEFSGNLVEICPTGVFTDKTHSERYNRKWDMQFAPSICQQCSIGCNISPGERYGELRRIENRYNGTVNHYFLCDRGRFGYGYVNLKDRPRQPVQRRGDDFITLNAEQAMQGAADILRQSKKVIGIGSPRASVESNFALRELVGEENFYTGIAHGEQERLQLALKVLREGGIYTPALREIESYDAVLVLGEDVTQTGARVALAVRQAVKGKAREMAAAQKVADWQIAAILNIGQRAKHPLFVTNVDDTRLDDIAAWTYRAPVEDQARLGFAIAHALDNSAPAVDGIEPELQSKIDVIVQALAGAKKPLIISGTNAGSLEVIQAAANVAKALKGRGADVGITMIARSVNSMGLGIMGGGSLEEALTELETGRADAVVVLENDLHRHASAIRVNAALAKAPLVMVVDHQRTAIMENAHLVLSAASFAESDGTVINNEGRAQRFFQVYDPAYYDSKTVMLESWRWLHSLHSTLLSREVDWTQLDHVIDAVVAKIPELAGIKDAAPDATFRIRGQKLAREPHRYSGRTAMRANISVHEPRQPQDIDTMFTFSMEGNNQPTAHRSQVPFAWAPGWNSPQAWNKFQDEVGGKLRFGDPGVRLFETSENGLDYFTSVPARFQPQDGKWRIAPYYHLFGSDELSQRAPVFQSRMPQPYIKLNPADAAKLGVNAGTRVSFSYDGNTVTLPVEIAEGLTAGQVGLPMGMSGIAPVLAGAHLEDLKEAQQ

Source Source

Source organism organism	Escherichia coli BW25113
NCBI taxonomy ID ncbi_taxonomy_id	679895
Host organism host_organism	Escherichia coli BW25113

Entity 4 Entity 4 polymer

Description description	NADH-quinone oxidoreductase subunit I
Molecular weight formula_weight	20562.8 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTLKELLVGFGTQVRSIWMIGLHAFAKRETRMYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFEMGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDKGEAENEAKPIDVKSLLP

Source Source

Source organism organism	Escherichia coli BW25113
NCBI taxonomy ID ncbi_taxonomy_id	679895
Host organism host_organism	Escherichia coli BW25113

Entity 5 Entity 5 polymer

Description description	NADH-quinone oxidoreductase subunit B
Molecular weight formula_weight	25081.8 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQSERERKRGERIAVTNLRTPDEI

Source Source

Source organism organism	Escherichia coli BW25113
NCBI taxonomy ID ncbi_taxonomy_id	679895
Host organism host_organism	Escherichia coli BW25113

Entity 6 Entity 6 polymer

Description description	NADH-quinone oxidoreductase subunit C/D
Molecular weight formula_weight	68780.5 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MVNNMTDLTAQEPAWQTRDHLDDPVIGELRNRFGPDAFTVQATRTGVPVVWIKREQLLEVGDFLKKLPKPYVMLFDLHGMDERLRTHREGLPAADFSVFYHLISIDRNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKGHPLRKDYPARATEFSPFELTKAKQDLEMEALTFKPEEWGMKRGTENEDFMFLNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNEMPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQKIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLREFLDWMPKRLASYEKAALQNTILKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDCYTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVSWGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPAAIRGSLVSDLIVYLGSIDFVMSDVDR

Source Source

Source organism organism	Escherichia coli BW25113
NCBI taxonomy ID ncbi_taxonomy_id	679895
Host organism host_organism	Escherichia coli BW25113

Entity 7 Entity 7 polymer

Description description	NADH-quinone oxidoreductase subunit A
Molecular weight formula_weight	16474.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

Source Source

Source organism organism	Escherichia coli BW25113
NCBI taxonomy ID ncbi_taxonomy_id	679895
Host organism host_organism	Escherichia coli BW25113

Entity 8 Entity 8 polymer

Description description	NADH-quinone oxidoreductase subunit H
Molecular weight formula_weight	36240.9 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,J,K,L

MSWISPELIEILLTILKAVVILLVVVTCGAFMSFGERRLLGLFQNRYGPNRVGWGGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSPGWVVADLNIGILFFLMMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTLSYEVFLGLSLMGVVAQAGSFNMTDIVNSQAHVWNVIPQFFGFITFAIAGVAVCHRHPFDQPEAEQELADGYHIEYSGMKFGLFFVGEYIGIVTISALMVTLFFGGWQGPLLPPFIWFALKTAFFMMMFILIRASLPRPRYDQVMSFGWKICLPLTLINLLVTAAVILWQAQ

Source Source

Source organism organism	Escherichia coli BW25113
NCBI taxonomy ID ncbi_taxonomy_id	679895
Host organism host_organism	Escherichia coli BW25113

Entity 9 Entity 9 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 10 Entity 10 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 11 Entity 11 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 12 Entity 12 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 13 Entity 13 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	258

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.66 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	70502

Local refinement of E. coli Complex I WT hydrophilic domain in LMNG

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-quinone oxidoreductase subunit E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit C/D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9tal__assembly_1__model_1

9tal__assembly_1__model_1 | I(q)

9tal__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer