7obq

SRP-SR at the distal site conformation

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Signal recognition particle 19

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	SRP RNA × 1 EM14S01-3B_G0054400.mRNA.1.CDS.1 × 1 （A0A7I9EWR8） Signal recognition particle subunit SRP68,Signal recognition particle subunit SRP68 × 1 （Q00004） Signal recognition particle receptor subunit beta × 1 （G1STG2） Signal recognition particle 54 kDa protein × 1 （P61010） SRP receptor subunit alpha × 1 （A0A5F9CI80） Signal recognition particle subunit SRP72 × 1 （P33731） MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J9PAS6_CANLF
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain q； PDBConstruct 1–144； UniProt 1–144

EM14S01-3B_G0054400.mRNA.1.CDS.1

Saccharomyces cerevisiae

UniProt A0A7I9EWR8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	SRP RNA × 1 Signal recognition particle 19 × 1 （J9PAS6） Signal recognition particle subunit SRP68,Signal recognition particle subunit SRP68 × 1 （Q00004） Signal recognition particle receptor subunit beta × 1 （G1STG2） Signal recognition particle 54 kDa protein × 1 （P61010） SRP receptor subunit alpha × 1 （A0A5F9CI80） Signal recognition particle subunit SRP72 × 1 （P33731） MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7I9EWR8_YEASX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain s； PDBConstruct 1–62； UniProt 1–62

Signal recognition particle subunit SRP68,Signal recognition particle subunit SRP68

OrganismNot specified

UniProt Q00004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	SRP RNA × 1 Signal recognition particle 19 × 1 （J9PAS6） EM14S01-3B_G0054400.mRNA.1.CDS.1 × 1 （A0A7I9EWR8） Signal recognition particle receptor subunit beta × 1 （G1STG2） Signal recognition particle 54 kDa protein × 1 （P61010） SRP receptor subunit alpha × 1 （A0A5F9CI80） Signal recognition particle subunit SRP72 × 1 （P33731） MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRP68_CANLF
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain u； PDBConstruct 1–493； UniProt 1–493 Author chain u； PDBConstruct 494–622； UniProt 494–622

Signal recognition particle receptor subunit beta

Oryctolagus cuniculus

UniProt G1STG2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	SRP RNA × 1 Signal recognition particle 19 × 1 （J9PAS6） EM14S01-3B_G0054400.mRNA.1.CDS.1 × 1 （A0A7I9EWR8） Signal recognition particle subunit SRP68,Signal recognition particle subunit SRP68 × 1 （Q00004） Signal recognition particle 54 kDa protein × 1 （P61010） SRP receptor subunit alpha × 1 （A0A5F9CI80） Signal recognition particle subunit SRP72 × 1 （P33731） MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G1STG2_RABIT
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain v； PDBConstruct 1–271； UniProt 1–271

Signal recognition particle 54 kDa protein

OrganismNot specified

UniProt P61010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	SRP RNA × 1 Signal recognition particle 19 × 1 （J9PAS6） EM14S01-3B_G0054400.mRNA.1.CDS.1 × 1 （A0A7I9EWR8） Signal recognition particle subunit SRP68,Signal recognition particle subunit SRP68 × 1 （Q00004） Signal recognition particle receptor subunit beta × 1 （G1STG2） SRP receptor subunit alpha × 1 （A0A5F9CI80） Signal recognition particle subunit SRP72 × 1 （P33731） MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRP54_CANLF
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain x； PDBConstruct 1–504； UniProt 1–504

SRP receptor subunit alpha

Oryctolagus cuniculus

UniProt A0A5F9CI80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	SRP RNA × 1 Signal recognition particle 19 × 1 （J9PAS6） EM14S01-3B_G0054400.mRNA.1.CDS.1 × 1 （A0A7I9EWR8） Signal recognition particle subunit SRP68,Signal recognition particle subunit SRP68 × 1 （Q00004） Signal recognition particle receptor subunit beta × 1 （G1STG2） Signal recognition particle 54 kDa protein × 1 （P61010） Signal recognition particle subunit SRP72 × 1 （P33731） MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5F9CI80_RABIT
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain y； PDBConstruct 1–637； UniProt 1–637

Signal recognition particle subunit SRP72

OrganismNot specified

UniProt P33731

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 1	SRP RNA × 1 Signal recognition particle 19 × 1 （J9PAS6） EM14S01-3B_G0054400.mRNA.1.CDS.1 × 1 （A0A7I9EWR8） Signal recognition particle subunit SRP68,Signal recognition particle subunit SRP68 × 1 （Q00004） Signal recognition particle receptor subunit beta × 1 （G1STG2） Signal recognition particle 54 kDa protein × 1 （P61010） SRP receptor subunit alpha × 1 （A0A5F9CI80） MAGNESIUM ION × 3 GUANOSINE-5'-TRIPHOSPHATE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRP72_CANLF
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain z； PDBConstruct 1–671； UniProt 1–671

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7obq
Deposition date deposition_date	2021-04-23
Structure title title	SRP-SR at the distal site conformation
Keywords keywords	SRP SRP receptor, co-translational protein targeting, endoplasmic reticulum, signal peptide, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7obq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7obq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7obq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.54 Å
Rg (electron density)	47.57 Å
Total Rg	47.63 Å
Atom count	16668
Residues	1840
Excluded volume	284000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7obq__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	SRP RNA
Molecular weight formula_weight	80701.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	1
Atom count atom_count	16668

GCCGGGCGCGGUGGCGCGCGCCUGUAGUCCCAGCUACUCGGGAGGCUGAGGCAGGAGGAUCGCUUCGCUAUGCCGAUCGGGUGUCCGCACUAAGUUCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCUAAGGAGGGGUGAACCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGAUCAGUAGUGGGAUCGCGCCUGUGAAUAGCAUAGCGAGACCCCGUCUC

Entity 2 Entity 2 polymer

Description description	Signal recognition particle 19
Molecular weight formula_weight	16183.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MACAAARSPAEQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGGDQSLQQGEGSKKGKGKKKK

Entity 3 Entity 3 polymer

Description description	EM14S01-3B_G0054400.mRNA.1.CDS.1
Molecular weight formula_weight	5294.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Oryctolagus cuniculus

Entity 4 Entity 4 polymer

Description description	Signal recognition particle subunit SRP68,Signal recognition particle subunit SRP68
Molecular weight formula_weight	67082.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MAAEKQVPGGGGGGGGGGGGGGGSGGGRGAGGEENKENERPSAGSKANREFGDSLSLEILQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEDLLTDNRYLLLVLMDAERAWSYAMQLKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESNRVDAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIAQAESEETKERLFESMLSECRDAIQAVREELKPDQKQRDYTLDGESGKVSNLQYLHSYLTYIKLSTAIRRNENMAKGLQKALQQQPEDESKRSPRPQDLIRLYDIILQNLVELLQLPGLEEDRAFQKEIGLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKYANEVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 5 Entity 5 polymer

Description description	Signal recognition particle receptor subunit beta
Molecular weight formula_weight	29846.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MASADSRRLGDGDGAGGAFQPYLDSLRQELQQRDPTVLSVVVALLAVLLTLVFWKLVRSRRSSQRAVLLLGLCDSGKTLLFVRLLTGHYRDTQTSITDSSATYRVNNNRGNSLTLIDLPGHESLRLQFLERFKTSARAVVFVVDSAAFQREVKDVAEFLYQVLIDSMSLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDPGSADIQDLEKWLAKIA

Source Source

Source organism organism	Oryctolagus cuniculus
Common name common_name	rabbit
NCBI taxonomy ID ncbi_taxonomy_id	9986
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Signal recognition particle 54 kDa protein
Molecular weight formula_weight	55775.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM

Entity 7 Entity 7 polymer

Description description	SRP receptor subunit alpha
Molecular weight formula_weight	69745.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKAVPAEKSGLPVGPENGVELSKEELIRRKREEFIQKHGRGLEKSSKSKSEAPKEKGKKAPRVWELGGCANKEVLDYSTPTTNGAPEAALSEDINLIRGTGPGGQLQDLDCSSSDDEGAAQNSTKPSSTKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAAISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA

Source Source

Source organism organism	Oryctolagus cuniculus
Common name common_name	rabbit
NCBI taxonomy ID ncbi_taxonomy_id	9986
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	Signal recognition particle subunit SRP72
Molecular weight formula_weight	74608.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNAACALIGQGQLSQAMKILQKAEDLCRRSLSEDSDGTEEDPQAELAIIHGQMAYILQLQGRTEEALQLYNQIIKLKPTDVGLLAVIANNIITINKDQNVFDSKKKVKLTNAEGVEFKLSKKQLQAIEFNKALLAMYTNQAEQCRKISASLQSQSPEHLLPVLIQAAQLCREKQHTKAIELLQEFSDQHPENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEEDIDSAIEVFTQAIQWYQNHQPKSSAHLSLIREAANFKLKYGRKKEAISDLEQLWKQNPKDIHTLAQLISAYSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSPGATYIRKKGGKVAGDSQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRKKGKKKDQIGKGTQGATAGASSELDASKTVSSPPTSPRPGSAATASASTSNIIPPRHQKPAGAPATKKKQQQKKKKGGKGGW

Entity 9 Entity 9 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 10 Entity 10 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 11 Entity 11 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
Molecular weight formula_weight	522.2 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	7obqy01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	450 — Beta-Lactamase
Homologous superfamily homologous superfamily	60 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	155989

SRP-SR at the distal site conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Signal recognition particle 19

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EM14S01-3B_G0054400.mRNA.1.CDS.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Signal recognition particle subunit SRP68,Signal recognition particle subunit SRP68

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Signal recognition particle receptor subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Signal recognition particle 54 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SRP receptor subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Signal recognition particle subunit SRP72

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7obq__assembly_1__model_1

7obq__assembly_1__model_1 | I(q)

7obq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source