2go5

Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Signal recognition particle 54 kDa protein (SRP54)

Canis sp.

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 2	SRP RNA × 1 ribosomal RNA × 1 Signal recognition particle 19 kDa protein (SRP19) × 1 Signal recognition particle receptor alpha subunit (SR a) × 1 （P08240） Signal recognition particle receptor beta subunit (SR b) × 1 （P47758） ribosomal protein L35 × 1 （Q8L805） ribosomal protein L23 × 1 ribosomal protein L31 × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRP54_CANFA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain W； PDBConstruct 1–109； UniProt 326–434

Signal recognition particle receptor alpha subunit (SR a)

Homo sapiens

UniProt P08240

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 2	SRP RNA × 1 ribosomal RNA × 1 Signal recognition particle 19 kDa protein (SRP19) × 1 Signal recognition particle 54 kDa protein (SRP54) × 1 （P61010） Signal recognition particle receptor beta subunit (SR b) × 1 （P47758） ribosomal protein L35 × 1 （Q8L805） ribosomal protein L23 × 1 ribosomal protein L31 × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRPR_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 1； PDBConstruct 12–185； UniProt 3–176

Signal recognition particle receptor beta subunit (SR b)

Mus musculus

UniProt P47758

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 2	SRP RNA × 1 ribosomal RNA × 1 Signal recognition particle 19 kDa protein (SRP19) × 1 Signal recognition particle 54 kDa protein (SRP54) × 1 （P61010） Signal recognition particle receptor alpha subunit (SR a) × 1 （P08240） ribosomal protein L35 × 1 （Q8L805） ribosomal protein L23 × 1 ribosomal protein L31 × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRPRB_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 2； PDBConstruct 3–214； UniProt 58–269

ribosomal protein L35

Triticum sp.

UniProt Q8L805

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 7 RNA 2	SRP RNA × 1 ribosomal RNA × 1 Signal recognition particle 19 kDa protein (SRP19) × 1 Signal recognition particle 54 kDa protein (SRP54) × 1 （P61010） Signal recognition particle receptor alpha subunit (SR a) × 1 （P08240） Signal recognition particle receptor beta subunit (SR b) × 1 （P47758） ribosomal protein L23 × 1 ribosomal protein L31 × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL35_WHEAT
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 5； PDBConstruct 1–124； UniProt 1–124

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2go5
Deposition date deposition_date	2006-04-12
Structure title title	Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex
Keywords keywords	SR, SRP, RIBOSOME, TRANSLATION-RNA COMPLEX; TRANSLATION/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2go5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2go5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2go5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.34 Å
Rg (electron density)	50.87 Å
Total Rg	50.82 Å
Atom count	10724
Residues	972
Excluded volume	174810 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2go5__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	SRP RNA
Molecular weight formula_weight	41199.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	10724

GACACUAAGUUCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCUAAGGAGGGGUGAACCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGAUCAGUAGUGU

Entity 2 Entity 2 polymer

Description description	ribosomal RNA
Molecular weight formula_weight	29170.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	9

CGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAA

Entity 3 Entity 3 polymer

Description description	Signal recognition particle 19 kDa protein (SRP19)
Molecular weight formula_weight	12561.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ

Source Source

Source organism organism	Canis sp.
NCBI taxonomy ID ncbi_taxonomy_id	9616

Entity 4 Entity 4 polymer

Description description	Signal recognition particle 54 kDa protein (SRP54)
Molecular weight formula_weight	12473.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

QFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKM

Source Source

Source organism organism	Canis sp.
NCBI taxonomy ID ncbi_taxonomy_id	9616

Entity 5 Entity 5 polymer

Description description	Signal recognition particle receptor alpha subunit (SR a)
Molecular weight formula_weight	21329.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MSHHHHHHSMVDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606

Entity 6 Entity 6 polymer

Description description	Signal recognition particle receptor beta subunit (SR b)
Molecular weight formula_weight	23537.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MARKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAEFLYQVLIDSMALKNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDTGSADIQDLEKWLAKIA

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090

Entity 7 Entity 7 polymer

Description description	ribosomal protein L35
Molecular weight formula_weight	14401.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MSSGKVKAGELWNKSKDDLTKQLAELKTELGQLRIQKVASSGSKLNRIHDIRKSIARVLTVINAKQRAQLRLFYKNKKYAPLDLRAKQTRAIRRRLSPDEKSRVLEKTKKRTVHFPQRKFAIKA

Source Source

Source organism organism	Triticum sp.
NCBI taxonomy ID ncbi_taxonomy_id	4569

Entity 8 Entity 8 polymer

Description description	ribosomal protein L23
Molecular weight formula_weight	16920.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAPKVAVAKKGDAKAQAAKVAKAVKSGSIKKTAKKIRTSVTFHRPKTLSKARDPKYPRISTPGRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGKKKAYVKLTPDYDALDVANKIGII

Source Source

Source organism organism	Triticum sp.
NCBI taxonomy ID ncbi_taxonomy_id	4569

Entity 9 Entity 9 polymer

Description description	ribosomal protein L31
Molecular weight formula_weight	14152.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MSEKKRAPGPRKDEVVTREYTVNLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTNDVRIDVKLNKHIWSSGIRSVPRRVRVRIARKRNDEEDAKEELYSLVTVAEVPQEGLKGLGTKVVEDED

Source Source

Source organism organism	Triticum sp.
NCBI taxonomy ID ncbi_taxonomy_id	4569

▼

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d2go511
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.110 — Profilin-like
Superfamily Superfamily superfamily	d.110.4 — SNARE-like
Family Family family	d.110.4.4 — SRP alpha N-terminal domain-like

Domain ID domain_id	d2go512
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2go521
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.8 — G proteins

Domain ID domain_id	d2go5b1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.201 — SRP19
Superfamily Superfamily superfamily	d.201.1 — SRP19
Family Family family	d.201.1.1 — SRP19

Domain ID domain_id	d2go5w1
Class class	a — All alpha proteins
Fold Fold fold	a.36 — Signal peptide-binding domain
Superfamily Superfamily superfamily	a.36.1 — Signal peptide-binding domain
Family Family family	a.36.1.1 — Signal peptide-binding domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	7.400 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	7.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	—

Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Signal recognition particle 54 kDa protein (SRP54)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Signal recognition particle receptor alpha subunit (SR a)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Signal recognition particle receptor beta subunit (SR b)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ribosomal protein L35

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2go5__assembly_1__model_1

2go5__assembly_1__model_1 | I(q)

2go5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 polymer

Polymer Polymer

Source Source

Entity 8 Entity 8 polymer

Polymer Polymer

Source Source

Entity 9 Entity 9 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (5 domains)

7. Citations (1)