SAXSdb — 2j37

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RIBOSOMAL PROTEIN L35

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 6 RNA 2 PDB declaration: octameric（8） Consistent with all polymer counts	Chain 5； UniProt 1–124	Not recorded	60S RIBOSOMAL PROTEIN L23 × 1 RIBOSOMAL PROTEIN L31 × 1 SRP RNA × 1 SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN (SRP19) × 1 （P09132） SIGNAL SEQUENCE × 1 SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN (SRP54) × 1 （P61010） RIBOSOMAL RNA × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2J37	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2GO5 Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex Deposited 2006-04-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 7 PDB declaration: nonameric	Chain 5 1–124（124 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.40 Å
4V3P The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes Deposited 2014-10-20	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 1863 PDB declaration: 2001-meric	Chain Lc 1–124（124 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 25MM HEPES-KOH, 3MM MG(OAC)2, 85MM KOAC,1.6MM DTT, 0.25MM SPERMIDINE；pH 7.6；25MM HEPES-KOH, 3MM MG(OAC)2, 85MM KOAC,1.6MM DTT, 0.25MM SPERMIDINE cryo-EM vitrification conditions Cryogen ETHANE；VITRIFICATION 1 --CRYOGEN- ETHANE, HUMIDITY-95, TEMPERATURE- 120,INSTRUMENT- FEI VITROBOT MARK IV, METHOD- 3UL OF SAMPLE APPLIED ON 300 MESH HOLY CARBON QUANTIFOIL GRID. BLOTTING WAS DONE IN VITROBOT MARK IV, BLOT TIME 0.5 SEC, BLOT FORCE 5	Resolution 34.00 Å
4V7E Model of the small subunit RNA based on a 5.5 A cryo-EM map of Triticum aestivum translating 80S ribosome Deposited 2013-11-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 82 PDB declaration: 88-meric	Chain Ch 1–124（124 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 mM HEPES/KOH, pH 7.5, 100 mM KOAc, 10 mM Mg(OAc)2, 0.01 mg/mL cycloheximide, 1 mM DTT, 0.01% Nikkol；pH 7.5；20 mM HEPES/KOH, pH 7.5, 100 mM KOAc, 10 mM Mg(OAc)2, 0.01 mg/mL cycloheximide, 1 mM DTT, 0.01% Nikkol cryo-EM vitrification conditions Blot for 10 seconds before plunging, use 2 layers of filter paper；Cryogen ETHANE；Blot for 10 seconds (using 2 layers of filter paper) before plunging into liquid ethane (FEI VITROBOT).	Resolution 5.50 Å
8IP8 Wheat 80S ribosome stalled on AUG-Stop boron dependently Deposited 2023-03-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 74 PDB declaration: 81-meric	Chain BB 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 307 ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8IPA Wheat 80S ribosome stalled on AUG-Stop boron dependently with cycloheximide Deposited 2023-03-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 74 PDB declaration: 80-meric	Chain BB 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 284 ZN ZINC ION × 4 3HE 4-{(2R)-2-[(1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl]-2-hydroxyethyl}piperidine-2,6-dione × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8IPB Wheat 80S ribosome pausing on AUG-Stop with cycloheximide Deposited 2023-03-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 73 PDB declaration: 79-meric	Chain BB 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 265 ZN ZINC ION × 4 3HE 4-{(2R)-2-[(1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl]-2-hydroxyethyl}piperidine-2,6-dione × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8JIV Atomic structure of wheat ribosome reveals unique features of the plant ribosomes Deposited 2023-05-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 41 PDB declaration: 44-meric	Chain Ch 1–124（124 aa）	Not recorded	K POTASSIUM ION × 72 MG MAGNESIUM ION × 242 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL35_WHEAT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 5； PDBConstruct 1–124； UniProt 1–124

SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN (SRP19)

OrganismNot specified

UniProt P09132

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 6 RNA 2 PDB declaration: octameric（8） Consistent with all polymer counts	Chain B； UniProt 14–120	Not recorded	60S RIBOSOMAL PROTEIN L23 × 1 RIBOSOMAL PROTEIN L35 × 1 （Q8L805） RIBOSOMAL PROTEIN L31 × 1 SRP RNA × 1 SIGNAL SEQUENCE × 1 SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN (SRP54) × 1 （P61010） RIBOSOMAL RNA × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2J37	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1JID Human SRP19 in complex with helix 6 of Human SRP RNA Deposited 2001-07-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 1–120（120 aa） Fragment：24 C-TERMINAL RESIDUES TRUNCATED	Not recorded	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；291 K；potassium chloride, magnesium chloride, sodium chloride, PEG 3350, isopropanol, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.222
1MFQ Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition Particle Deposited 2002-08-13	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 2 PDB declaration: trimeric	Chain B 14–120（107 aa）	Not recorded	MG MAGNESIUM ION × 5 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；300.5 K；14% (w/v) PEG8000, 100mM Na-cacodylate, 400mM lithium sulfate, 80mM magnesium chloride, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 300.5K	Resolution 3.10 Å R-free 0.267
3KTV Crystal structure of the human SRP19/S-domain SRP RNA complex Deposited 2009-11-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain B 1–120（120 aa）	Not recorded	K POTASSIUM ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；291 K；100 mM NaOAc, 0.75 M KF, 2.2 M (NH4)2SO4, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.80 Å R-free 0.329
3KTV Crystal structure of the human SRP19/S-domain SRP RNA complex Deposited 2009-11-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain D 1–120（120 aa）	Not recorded	K POTASSIUM ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；291 K；100 mM NaOAc, 0.75 M KF, 2.2 M (NH4)2SO4, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.80 Å R-free 0.329
4P3E Structure of the human SRP S domain Deposited 2014-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 2 PDB declaration: trimeric	Chain B 1–120（120 aa） Fragment：UNP residues 1-120	Not recorded	MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；291 K；Ammonium sulfate, Sodium malonate	Resolution 3.50 Å R-free 0.285
5M73 Structure of the human SRP S domain with SRP72 RNA-binding domain Deposited 2016-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 3 PDB declaration: tetrameric	Chain B 11–118（108 aa）	Not recorded	MG MAGNESIUM ION × 30 K POTASSIUM ION × 5 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；17 % (w/v) PEG3350 0.1 M KF 0.1 M Tris pH 8.5	Resolution 3.40 Å R-free 0.280
5M73 Structure of the human SRP S domain with SRP72 RNA-binding domain Deposited 2016-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 3 PDB declaration: tetrameric	Chain F 11–118（108 aa）	Not recorded	MG MAGNESIUM ION × 15 K POTASSIUM ION × 5 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；17 % (w/v) PEG3350 0.1 M KF 0.1 M Tris pH 8.5	Resolution 3.40 Å R-free 0.280
7NFX Mammalian ribosome nascent chain complex with SRP and SRP receptor in early state A Deposited 2021-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 51 PDB declaration: 55-meric	Chain q 1–144（144 aa）	Not recorded	ZN ZINC ION × 5 MG MAGNESIUM ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7QWQ Ternary complex of ribosome nascent chain with SRP and NAC Deposited 2022-01-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 48 PDB declaration: 52-meric	Chain q 1–144（144 aa）	Not recorded	MG MAGNESIUM ION × 97 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.83 Å

7 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SRP19_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 2–108； UniProt 14–120

SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN (SRP54)

OrganismNot specified

UniProt P61010

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 6 RNA 2 PDB declaration: octameric（8） Consistent with all polymer counts	Chain W； UniProt 1–504	Not recorded	60S RIBOSOMAL PROTEIN L23 × 1 RIBOSOMAL PROTEIN L35 × 1 （Q8L805） RIBOSOMAL PROTEIN L31 × 1 SRP RNA × 1 SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN (SRP19) × 1 （P09132） SIGNAL SEQUENCE × 1 RIBOSOMAL RNA × 1	ELECTRON MICROSCOPY cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2J37	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2GO5 Structure of signal recognition particle receptor (SR) in complex with signal recognition particle (SRP) and ribosome nascent chain complex Deposited 2006-04-12	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 7 PDB declaration: nonameric	Chain W 326–434（109 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.40 Å
4UE5 Structural basis for targeting and elongation arrest of Bacillus signal recognition particle Deposited 2014-12-15	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 6 PDB declaration: heptameric	Chain D 1–433（433 aa） Fragment：UNP RESIDUES 1-433	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions Cryogen ETHANE；VITRIFICATION 1 -- CRYOGEN- ETHANE, INSTRUMENT- FEI VITROBOT MARK IV,	Resolution 9.00 Å
6FRK Structure of a prehandover mammalian ribosomal SRP and SRP receptor targeting complex Deposited 2018-02-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 58-meric	Chain x 1–504（504 aa）	Not recorded	MG MAGNESIUM ION × 133 ZN ZINC ION × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.70 Å
6R6G Structure of XBP1u-paused ribosome nascent chain complex with SRP. Deposited 2019-03-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 84 PDB declaration: 92-meric	Chain AB 4–434（431 aa）	Not recorded	MG MAGNESIUM ION × 299 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7OBQ SRP-SR at the distal site conformation Deposited 2021-04-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 7 PDB declaration: octameric	Chain x 1–504（504 aa）	Not recorded	MG MAGNESIUM ION × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
7OBR RNC-SRP early complex Deposited 2021-04-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 53-meric	Chain x 1–504（504 aa）	Not recorded	MG MAGNESIUM ION × 97 ZN ZINC ION × 5 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.80 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SRP54_CANFA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain W； PDBConstruct 1–504； UniProt 1–504

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2j37
Deposition date deposition_date	2006-08-18
Structure title title	MODEL OF MAMMALIAN SRP BOUND TO 80S RNCS
Keywords keywords	RIBOSOME, SRP, TRANSLATION/RNA; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	54.42 Å
Radius of gyration Rg (electron density) rg_electron	53.29 Å
Forward intensity I(0) i0	1518970000.00
Molecular weight molecular_weight	223200.0 kDa
Excluded volume excluded_volume	237040 Å³
Envelope volume envelope_volume	424330 Å³
Hydration-shell volume shell_volume	70558 Å³
Envelope diameter envelope_diameter	191.0 Å
Shell Rg shell_rg	52.35 Å
Envelope Rg envelope_rg	51.61 Å
Shape Rg shape_rg	53.17 Å
Total Rg total_rg	53.49 Å
Total atoms total_atoms	15110
Residues n_residues	1237
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	180.8 Å
Rg (real space) rg_real	54.61 Å
Rg uncertainty (real space) rg_real_error	1.59 Å
I(0) (real space) i0_real	1.5190e+09
I(0) uncertainty (real space) i0_real_error	3.0960e+07
Rg (reciprocal space) rg_reciprocal	54.25 Å
I(0) (reciprocal space) i0_reciprocal	1518000000.0000
Solution quality estimate total_estimate	0.8532
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	62.3 Å
Skewness Skewness skewness	0.422
Kurtosis Kurtosis kurtosis	-0.229
Angular range angular_range	— – 0.1450 Å⁻¹
Current regularization parameter α current_alpha	0.0002
Highest regularization parameter α highest_alpha	29110000.0000
Real-space data points n_real_points	30
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.906; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.371

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	60S RIBOSOMAL PROTEIN L23
Molecular weight formula_weight	16920.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4
Atom count atom_count	15110

MAPKVAVAKKGDAKAQAAKVAKAVKSGSIKKTAKKIRTSVTFHRPKTLSKARDPKYPRISTPGRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGKKKAYVKLTPDYDALDVANKIGII

Entity 2 Entity 2 polymer

Description description	RIBOSOMAL PROTEIN L35
Molecular weight formula_weight	14401.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MSSGKVKAGELWNKSKDDLTKQLAELKTELGQLRIQKVASSGSKLNRIHDIRKSIARVLTVINAKQRAQLRLFYKNKKYAPLDLRAKQTRAIRRRLSPDEKSRVLEKTKKRTVHFPQRKFAIKA

Entity 3 Entity 3 polymer

Description description	RIBOSOMAL PROTEIN L31
Molecular weight formula_weight	14152.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MSEKKRAPGPRKDEVVTREYTVNLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTNDVRIDVKLNKHIWSSGIRSVPRRVRVRIARKRNDEEDAKEELYSLVTVAEVPQEGLKGLGTKVVEDED

Entity 4 Entity 4 polymer

Description description	SRP RNA
Molecular weight formula_weight	41504.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A

GACACUAAGUUCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCUAAGGAGGGGUGAACCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGAUCAGUAGUGUC

Entity 5 Entity 5 polymer

Description description	SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN (SRP19)
Molecular weight formula_weight	12561.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ

Entity 6 Entity 6 polymer

Description description	SIGNAL SEQUENCE
Molecular weight formula_weight	1992.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

LGFPINFLTLYVTVQHK

Entity 7 Entity 7 polymer

Description description	SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN (SRP54)
Molecular weight formula_weight	55775.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM

Entity 8 Entity 8 polymer

Description description	RIBOSOMAL RNA
Molecular weight formula_weight	90695.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Z

CUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCACAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACGGGGUCGAUCACGCUGGGCAUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUC

▼

7. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2j37b1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.201 — SRP19
Superfamily Superfamily superfamily	d.201.1 — SRP19
Family Family family	d.201.1.1 — SRP19

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	8.700 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	8.70 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	—

fit	/app/data/saxs_computation/j3/2j37/2j37.fit
pddf	/app/data/pr_computation/j3/2j37/2j37.pr.out
profile	/app/data/saxs_computation/j3/2j37/2j37.dat

MODEL OF MAMMALIAN SRP BOUND TO 80S RNCS

1. Protein Identity and Related Structures Protein Identity & Related Structures

RIBOSOMAL PROTEIN L35

State in the Current Structure

Other States of the Same Protein in the Database

SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN (SRP19)

State in the Current Structure

Other States of the Same Protein in the Database

SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN (SRP54)

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

7. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)