7oui

Structure of C2S2M2-type Photosystem supercomplex from Arabidopsis thaliana (digitonin-extracted)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q39142_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–266； UniProt 1–266 Author chain 3； PDBConstruct 1–266； UniProt 1–266 Author chain 5； PDBConstruct 1–266； UniProt 1–266 Author chain 7； PDBConstruct 1–266； UniProt 1–266

Chlorophyll a-b binding protein 3, chloroplastic

OrganismNot specified

UniProt Q9S7M0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB3_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–243； UniProt 23–265 Author chain 6； PDBConstruct 1–243； UniProt 23–265

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q9LMQ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9LMQ2_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 4； PDBConstruct 1–212； UniProt 47–258 Author chain 8； PDBConstruct 1–212； UniProt 47–258

Photosystem II protein D1

OrganismNot specified

UniProt P83755

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_ARATH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–352； UniProt 2–353 Author chain a； PDBConstruct 1–352； UniProt 2–353

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt P56777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBB_ARATH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–508； UniProt 1–508 Author chain b； PDBConstruct 1–508； UniProt 1–508

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt P56778

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_ARATH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 1–459； UniProt 15–473 Author chain c； PDBConstruct 1–459； UniProt 15–473

Photosystem II D2 protein

OrganismNot specified

UniProt P56761

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_ARATH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D； PDBConstruct 1–352； UniProt 2–353 Author chain d； PDBConstruct 1–352； UniProt 2–353

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt P56779

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_ARATH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain E； PDBConstruct 1–83； UniProt 1–83 Author chain e； PDBConstruct 1–83； UniProt 1–83

Cytochrome b559 subunit beta (PsbF)

OrganismNot specified

UniProt P62095

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_ARATH
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain F； PDBConstruct 1–39； UniProt 1–39 Author chain f； PDBConstruct 1–39； UniProt 1–39

Photosystem II reaction center protein H

OrganismNot specified

UniProt P56780

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_ARATH
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain H； PDBConstruct 1–72； UniProt 2–73 Author chain h； PDBConstruct 1–72； UniProt 2–73

Photosystem II reaction center protein I

OrganismNot specified

UniProt P62100

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_ARATH
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain I； PDBConstruct 1–36； UniProt 1–36 Author chain i； PDBConstruct 1–36； UniProt 1–36

Photosystem II reaction center protein K

OrganismNot specified

UniProt P56782

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_ARATH
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain K； PDBConstruct 1–37； UniProt 25–61 Author chain k； PDBConstruct 1–37； UniProt 25–61

Photosystem II reaction center protein L

OrganismNot specified

UniProt P60129

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_ARATH
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain L； PDBConstruct 1–38； UniProt 1–38 Author chain l； PDBConstruct 1–38； UniProt 1–38

Photosystem II reaction center protein M

OrganismNot specified

UniProt P62109

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_ARATH
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain M； PDBConstruct 1–34； UniProt 1–34 Author chain m； PDBConstruct 1–34； UniProt 1–34

Oxygen-evolving enhancer protein 1-1, chloroplastic

OrganismNot specified

UniProt P23321

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBO1_ARATH
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain O； PDBConstruct 1–247； UniProt 86–332 Author chain o； PDBConstruct 1–247； UniProt 86–332

Photosystem II reaction center protein T

OrganismNot specified

UniProt P61839

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_ARATH
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain T； PDBConstruct 1–33； UniProt 1–33 Author chain t； PDBConstruct 1–33； UniProt 1–33

Photosystem II reaction center W protein, chloroplastic

OrganismNot specified

UniProt Q39194

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBW_ARATH
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain W； PDBConstruct 1–54； UniProt 80–133 Author chain w； PDBConstruct 1–54； UniProt 80–133

(thale cress) hypothetical protein

OrganismNot specified

UniProt A0A7G2E9B1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7G2E9B1_ARATH
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain X； PDBConstruct 1–42； UniProt 314–355 Author chain x； PDBConstruct 1–42； UniProt 314–355

Photosystem II reaction center protein Z

OrganismNot specified

UniProt P56790

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_ARATH
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62 Author chain z； PDBConstruct 1–62； UniProt 1–62

Chlorophyll a-b binding protein CP26, chloroplastic

OrganismNot specified

UniProt Q9XF89

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB5_ARATH
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain S； PDBConstruct 1–232； UniProt 49–280 Author chain s； PDBConstruct 1–232； UniProt 49–280

Chlorophyll a-b binding protein 1, chloroplastic

OrganismNot specified

UniProt P04778

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB1C_ARATH
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain G； PDBConstruct 1–232； UniProt 36–267 Author chain N； PDBConstruct 1–232； UniProt 36–267 Author chain Y； PDBConstruct 1–232； UniProt 36–267 Author chain g； PDBConstruct 1–232； UniProt 36–267 Author chain n； PDBConstruct 1–232； UniProt 36–267 Author chain y； PDBConstruct 1–232； UniProt 36–267

Chlorophyll a-b binding protein CP29.1, chloroplastic

OrganismNot specified

UniProt Q07473

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Photosystem II 5 kDa protein, chloroplastic × 2 （Q39195） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB4A_ARATH
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain R； PDBConstruct 1–250； UniProt 41–290 Author chain r； PDBConstruct 1–250； UniProt 41–290

Photosystem II 5 kDa protein, chloroplastic

OrganismNot specified

UniProt Q39195

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 52	Chlorophyll a-b binding protein, chloroplastic × 4 （Q39142） Chlorophyll a-b binding protein 3, chloroplastic × 2 （Q9S7M0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） (thale cress) hypothetical protein × 2 （A0A7G2E9B1） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 6 （P04778） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） CHLOROPHYLL B × 60 CHLOROPHYLL A × 162 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 Digitonin × 22 BICARBONATE ION × 2 FE (II) ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 CALCIUM ION × 4 CHLORIDE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 10 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PST2_ARATH
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain U； PDBConstruct 1–28； UniProt 76–103 Author chain u； PDBConstruct 1–28； UniProt 76–103

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7oui
Deposition date deposition_date	2021-06-11
Structure title title	Structure of C2S2M2-type Photosystem supercomplex from Arabidopsis thaliana (digitonin-extracted)
Keywords keywords	Oxidoreductase, Complex, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7oui__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7oui__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7oui__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	84.22 Å
Rg (electron density)	83.74 Å
Total Rg	83.34 Å
Atom count	85758
Residues	8342
Excluded volume	1565100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7oui__assembly_1__model_1`	52-meric （52）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (42)

Entity 1 Entity 1 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	28193.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,3,5,7
Atom count atom_count	85897

MAASTMALSSPALTGKAVKLSPAASEVFGTGRITMRKASKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGDGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Entity 2 Entity 2 polymer

Description description	Chlorophyll a-b binding protein 3, chloroplastic
Molecular weight formula_weight	26453.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,6

ASSFNPLRDVVSLGSPKYTMGNDLWYGPDRVKYLGPFSVQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGAFGCITPEVLQKWVRVDFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVILMGLVEGFRINGLDGVGEGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWAFATKFAPGA

Entity 3 Entity 3 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23198.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,8

AAAAAQPKKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGVAWFEAGAQPDAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSKTAENFANYTGDQGYPGGRFFDPLGLAGKNRDGVYEPDFEKLERLKLAEIKHSRLAMVAMLIFYFEAGQGKTPLGALGL

Entity 4 Entity 4 polymer

Description description	Photosystem II protein D1
Molecular weight formula_weight	38830.1 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a

TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAVEAPSTNG

Entity 5 Entity 5 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	56091.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEAWAKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFAGIDPDLDAQVEFGAFQKLGDPTTKRQAV

Entity 6 Entity 6 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	50086.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAFLLVFKALYFGGVYDTWAPGGGDVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILTKPFAWARRALVWSGEAYLSYSLAALSVCGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN

Entity 7 Entity 7 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39444.1 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

TIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Entity 8 Entity 8 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9393.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSRSF

Entity 9 Entity 9 polymer

Description description	Cytochrome b559 subunit beta (PsbF)
Molecular weight formula_weight	4428.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	7575.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

ATQTVEDSSRSGPRSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISVN

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4170.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	4239.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

KLPEAYAFLNPIVDVMPVIPLFFLLLAFVWQAAVSFR

Entity 13 Entity 13 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4471.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MTQSNPNEQSVELNRTSLYWGLLLIFVLAVLFSNYFFN

Entity 14 Entity 14 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3783.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

Entity 15 Entity 15 polymer

Description description	Oxygen-evolving enhancer protein 1-1, chloroplastic
Molecular weight formula_weight	26594.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,o

EGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE

Entity 16 Entity 16 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3825.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

MEALVYTFLLVSTLGIIFFAIFFREPPKISTKK

Entity 17 Entity 17 polymer

Description description	Photosystem II reaction center W protein, chloroplastic
Molecular weight formula_weight	6036.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,w

LVDERMSTEGTGLPFGLSNNLLGWILFGVFGLIWTFFFVYTSSLEEDEESGLSL

Entity 18 Entity 18 polymer

Description description	(thale cress) hypothetical protein
Molecular weight formula_weight	4186.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

AGSGISPSLKNFLLSIASGGLVLTVIIGVVVGVSNFDPVKRT

Entity 19 Entity 19 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6569.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MTIAFQLAVFALIITSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS

Entity 20 Entity 20 polymer

Description description	Chlorophyll a-b binding protein CP26, chloroplastic
Molecular weight formula_weight	25232.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,s

SKAVSETSDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAGTAERAPTL

Entity 21 Entity 21 polymer

Description description	Chlorophyll a-b binding protein 1, chloroplastic
Molecular weight formula_weight	24885.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,N,Y,g,n,y

RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK

Entity 22 Entity 22 polymer

Description description	Chlorophyll a-b binding protein CP29.1, chloroplastic
Molecular weight formula_weight	27302.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,r

AAPKKSAKKTVTTDRPLWYPGAISPDWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS

Entity 23 Entity 23 polymer

Description description	Photosystem II 5 kDa protein, chloroplastic
Molecular weight formula_weight	3178.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,u

EPKRGTEAAKKKYAQVCVTMPTAKICRY

Entity 24 Entity 24 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	60

Entity 25 Entity 25 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	162

Entity 26 Entity 26 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	30

Entity 27 Entity 27 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 28 Entity 28 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 29 Entity 29 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 30 Entity 30 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 31 Entity 31 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 32 Entity 32 non-polymer

Description description	Digitonin
Molecular weight formula_weight	1229.3 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 33 Entity 33 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 34 Entity 34 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 35 Entity 35 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 36 Entity 36 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 37 Entity 37 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 38 Entity 38 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 39 Entity 39 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 40 Entity 40 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 41 Entity 41 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 42 Entity 42 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	139

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	7oui401
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7oui801
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7ouiA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	7ouiN01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7ouiS01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7ouia01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	7ouin01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7ouis01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.79 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	100712

Structure of C2S2M2-type Photosystem supercomplex from Arabidopsis thaliana (digitonin-extracted)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II protein D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta (PsbF)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer