SAXSdb — 7ozs

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative ribosomal protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	60S ribosomal protein l5-like protein × 1 （G0SEG2） Ribosome biogenesis regulatory protein × 1 （G0SCH6） Ribosome production factor 2 homolog × 1 （G0SF80） 5S rRNA × 1 unknown × 1 Syo1 × 1 （G0S5S6）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SHQ2_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–173； UniProt 1–173

60S ribosomal protein l5-like protein

OrganismNot specified

UniProt G0SEG2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Putative ribosomal protein × 1 （G0SHQ2） Ribosome biogenesis regulatory protein × 1 （G0SCH6） Ribosome production factor 2 homolog × 1 （G0SF80） 5S rRNA × 1 unknown × 1 Syo1 × 1 （G0S5S6）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SEG2_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–304； UniProt 1–304

Ribosome biogenesis regulatory protein

OrganismNot specified

UniProt G0SCH6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Putative ribosomal protein × 1 （G0SHQ2） 60S ribosomal protein l5-like protein × 1 （G0SEG2） Ribosome production factor 2 homolog × 1 （G0SF80） 5S rRNA × 1 unknown × 1 Syo1 × 1 （G0S5S6）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SCH6_CHATD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–202； UniProt 1–202

Ribosome production factor 2 homolog

OrganismNot specified

UniProt G0SF80

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Putative ribosomal protein × 1 （G0SHQ2） 60S ribosomal protein l5-like protein × 1 （G0SEG2） Ribosome biogenesis regulatory protein × 1 （G0SCH6） 5S rRNA × 1 unknown × 1 Syo1 × 1 （G0S5S6）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SF80_CHATD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–350； UniProt 1–350

Syo1

OrganismNot specified

UniProt G0S5S6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 1	Putative ribosomal protein × 1 （G0SHQ2） 60S ribosomal protein l5-like protein × 1 （G0SEG2） Ribosome biogenesis regulatory protein × 1 （G0SCH6） Ribosome production factor 2 homolog × 1 （G0SF80） 5S rRNA × 1 unknown × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S5S6_CHATD
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain F； PDBConstruct 1–676； UniProt 1–676

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ozs
Deposition date deposition_date	2021-06-28
Structure title title	Structure of the hexameric 5S RNP from C. thermophilum
Keywords keywords	5S RNP, Ribosome biogenesis, Symportin 1, Rpf2-Rrs1, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ozs__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ozs__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ozs__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.30 Å
Rg (electron density)	40.77 Å
Total Rg	40.95 Å
Atom count	12770
Residues	1456
Excluded volume	218060 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ozs__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Putative ribosomal protein
Molecular weight formula_weight	20119.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	12770

MSSEKAQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRQFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGFGISEHIDLGIKYDPSIGIYGMDFYCCMTRPGERVAKRRRCKSRIGASHRITREETIRWFKQRFDGIVR

Entity 2 Entity 2 polymer

Description description	60S ribosomal protein l5-like protein
Molecular weight formula_weight	35034.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAFHKLVKNSAYYSRFQTKFKRRRQGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNRDIITQMVTSEINGDKIFAAAYSHELRAYGINHGLTNWAAAYATGLLLARRVLAKLGLDKTFTGVEEPNGEYTLTEAAETEDGERRPFKAILDVGLARTSTGARVFGVMKGASDGGIFIPHSENRFPGYDIETEELDTEVLKKYIYGGHVAEYMETLADDDEERYKSQFVKYIEDDVEADSLEELYAEAHKQIRADPFRKYVSDAPKKSKEEWKAESLKYKKAKLSREERKARVEAKIKQLLAEQDE

Entity 3 Entity 3 polymer

Description description	Ribosome biogenesis regulatory protein
Molecular weight formula_weight	22817.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSTDTSKPARLPVTVEKPTPYTFDLGLLLANDPNPVNVPKTTDTQVLEQHLASVARDGAQVLINQLLTTTTITATKDGVLLTLPPPTTPLPREKPVPQPKPETKWQAFARRRGIKPKTREQRRNLQYNPTTGQWERKWGYKGANKRGETDPIIEVSAAKEAMRPEGTSVRGDKRREIRARVKKNQKQMLRNQRIAAEKMGKK

Entity 4 Entity 4 polymer

Description description	Ribosome production factor 2 homolog
Molecular weight formula_weight	39927.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MLRQIKPRNARSKRALEKRAPKIVENPKTCLFLRGTTCSQITQDAMNDLYAMRQVHAKRFHKKNAIHPFEDATSLCFFSEKNDCSLMVFGSSNKKRPHTLTFVRMFDYKVLDMLEFYLDPDTYRSISQFKTSKIPIGMRPMMVFAGTAFESPVPNAFTMAKSMLIDFFRGEPSDKIDVEGLRFVVVVTADEPTSSTSTNNDGENPAPLPGMTDPRSIDPSQKPILRLRVYGIRTKRSGTRLPRVEVEEHGPRMDFRLGRMREPDPAMLKEAMKKAKTPQEERTKKNISMDLLGDKIGRIHMGKTDLSKLQTRKMKGLKRGRDEDEGGEDDRTDVVEAGSGEKKKKKKVKG

Entity 5 Entity 5 polymer

Description description	5S rRNA
Molecular weight formula_weight	38312.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	3

ACGUACGACCAUACCCAGUGGAAAGCACGGCAUCCCGUCCGCUCUGCCCUAGUUAAGCCACUGAGGGCCCGGUUAGUAGUUGGGUCGGUGACGACCAGCGAAUCCCGGGUGUUGUACGU

Entity 6 Entity 6 polymer

Description description	unknown
Molecular weight formula_weight	1975.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

XXXXXXXXXXXXXXXXXXXXXXX

Entity 7 Entity 7 polymer

Description description	Syo1
Molecular weight formula_weight	74709.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MGKTRRNRVRNRTDPIAKPVKPPTDPELAKLREDKILPVLKDLKSPDAKSRTTAAGAIANIVQDAKCRKLLLREQVVHIVLTETLTDNNIDSRAAGWEILKVLAQEEEADFCVHLYRLDVLTAIEHAAKAVLETLTTSEPPFSKLLKAQQRLVWDITGSLLVLIGLLALARDEIHEAVATKQTILRLLFRLISADIAPQDIYEEAISCLTTLSEDNLKVGQAITDDQETHVYDVLLKLATGTDPRAVMACGVLHNVFTSLQWMDHSPGKDGACDAILIPTLTRALEHVVPGGAKFNGDARYANITLLALVTLASIGTDFQETLVKGNQGSRESPISAADEEWNGFDDADGDAMDVDQKSSSGEDQEEDYEEIDVKEDDEDDDDDSITSEMQADMERVVGADGTDDGDLEDLPTLRELIQTAVPQLIRLSNLPIDSDESLTIQSHALSALNNISWTISCLEFANGENANIHNAWYPTAKKIWRKTILPILEADSADLKLATQVTSLAWAVARVLHGETPTDGNPHRKFISLYHSSKQQAGGNSNSIEEPEDPFQGLGVKCIGVVGSLAHDPAPIEVNREVGVFLVTLLRQSNNVPPAEIVEALNQLFDIYGDEELACDKEVFWKDGFLKHLEEFLPKMRTLTKGIDKRTQPELRTRADEALLNLGRFVQYKKKHAPK

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	7ozsA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	100 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	126547

Structure of the hexameric 5S RNP from C. thermophilum

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative ribosomal protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

60S ribosomal protein l5-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosome biogenesis regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosome production factor 2 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Syo1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ozs__assembly_1__model_1

7ozs__assembly_1__model_1 | I(q)

7ozs__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)