SAXSdb — 7pgx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NPH1-1

Avena sativa

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain AAA； UniProt 404–546	Not recorded	CA CALCIUM ION × 1 CL CHLORIDE ION × 1 GOL GLYCEROL × 10 PEG DI(HYDROXYETHYL)ETHER × 2 EDO 1,2-ETHANEDIOL × 2 ACT ACETATE ION × 1 FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 4.6；295 K；0.1 M sodium acetate pH 4.6-5.0, 6-8% (w/v) PEG 4000, 30% (v/v) glycerol	Resolution 1.00 Å R-free 0.147

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7PGX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2V0U n- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal transduction (cryo dark structure of lov2 (404-546)) Deposited 2007-05-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa） Fragment：LIGHT, OXYGEN, VOLTAGE DOMAIN, RESIDUES 404-546	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1 GOL GLYCEROL × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.40 Å R-free 0.197
2V0W N- and C-terminal helices of oat LOV2 (404-546) are involved in light- induced signal transduction (cryo-trapped light structure of LOV2 (404-546)) Deposited 2007-05-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa） Fragment：LIGHT, OXYGEN, VOLTAGE DOMAIN, RESIDUES 404-546	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；Reservoir: 0.07 M sodium acetate, pH 4.6, 5.6% PEG 4000, 30% glycerol	Resolution 1.70 Å R-free 0.215
2V1A N- and C-terminal helices of oat LOV2 (404-546) are involved in light-induced signal transduction (room temperature (293K) dark structure of LOV2 (404-546)) Deposited 2007-05-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa） Fragment：LIGHT, OXYGEN, VOLTAGE DOMAIN, RESIDUES 404-546	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP	Resolution 1.65 Å R-free 0.195
2V1B N- and C-terminal helices of oat LOV2 (404-546) are involved in light-induced signal transduction (room temperature (293K) light structure of LOV2 (404-546)) Deposited 2007-05-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa） Fragment：LIGHT, OXYGEN, VOLTAGE DOMAIN, RESIDUES 404-546	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.55 Å R-free 0.212
2WKP Structure of a photoactivatable Rac1 containing Lov2 Wildtype Deposited 2009-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa） Fragment：NPH1-1, RESIDUES 404-546 AND P21-RAC1, RESIDUES 4-180	Mutation：YES	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 FMN FLAVIN MONONUCLEOTIDE × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 100 MM CA ACETATE, 100 MM SODIUM CACODYLATE PH 5.5, 12 % (W/V) PEG 8000	Resolution 1.90 Å R-free 0.195
2WKQ Structure of a photoactivatable Rac1 containing the Lov2 C450A Mutant Deposited 2009-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa） Fragment：NPH1-1 RESIDUES 404-546 AND P21-RAC1, RESIDUES 4-180	Mutation：YES	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 FMN FLAVIN MONONUCLEOTIDE × 1 MG MAGNESIUM ION × 1 CL CHLORIDE ION × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions 100 MM POTASSIUM CHLORIDE, 5% (W/V) PEG 4000	Resolution 1.60 Å R-free 0.186
2WKR Structure of a photoactivatable Rac1 containing the Lov2 C450M Mutant Deposited 2009-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa） Fragment：NPH1-1, RESIDUES 404-546 AND P21-RAC1, RESIDUES 4-180	Mutation：YES	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 FMN FLAVIN MONONUCLEOTIDE × 1 MG MAGNESIUM ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions 18 % (V/V) PEG 600	Resolution 2.20 Å R-free 0.226
4WF0 Crystal Structure of iLID - an Improved Light-Inducible Dimer Deposited 2014-09-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–543（140 aa） Fragment：UNP residues 405-543	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；Grown in dark for 3 days. Conditions: 100mM TRIS:HCl pH 8.5, 800mM Lithium Chloride, 32% PEG 4000	Resolution 1.95 Å R-free 0.244
4WF0 Crystal Structure of iLID - an Improved Light-Inducible Dimer Deposited 2014-09-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 404–543（140 aa） Fragment：UNP residues 405-543	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；Grown in dark for 3 days. Conditions: 100mM TRIS:HCl pH 8.5, 800mM Lithium Chloride, 32% PEG 4000	Resolution 1.95 Å R-free 0.244
5EFW Crystal structure of LOV2-Zdk1 - the complex of oat LOV2 and the affibody protein Zdark1 Deposited 2015-10-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 404–546（143 aa） Fragment：UNP residues 404-546	Mutation：C450A	FMN FLAVIN MONONUCLEOTIDE × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 3.5；293.15 K；2 M ammonium sulfate, 0.1 M sodium citrate pH 3.5	Resolution 2.10 Å R-free 0.257
5HZH Crystal structure of photoinhibitable Rac1 containing C450A mutant LOV2 domain Deposited 2016-02-02	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa）	Mutation：Q61L,Q61L,Q61L,Q61L,Q61L,Q61L,Q61L,Q61L,Q61L	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 FMN FLAVIN MONONUCLEOTIDE × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.2 M calcium acetate, 26% (w/v) PEG 3350	Resolution 2.60 Å R-free 0.255
5HZI Crystal structure of photoinhibitable Intersectin1 containing C450M mutant LOV2 domain Deposited 2016-02-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa）	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1 M HEPES pH 7.5, 9% (w/v) PEG 8000, 9% (v/v) ethylene glycol	Resolution 2.60 Å R-free 0.285
5HZI Crystal structure of photoinhibitable Intersectin1 containing C450M mutant LOV2 domain Deposited 2016-02-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 404–546（143 aa）	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1 M HEPES pH 7.5, 9% (w/v) PEG 8000, 9% (v/v) ethylene glycol	Resolution 2.60 Å R-free 0.285
5HZJ Crystal structure of photoinhibitable Intersectin1 containing wildtype LOV2 domain Deposited 2016-02-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 404–546（143 aa）	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1 M HEPES pH 7.5, 9% (w/v) PEG 8000, 9% (v/v) ethylene glycol	Resolution 2.60 Å R-free 0.281
5HZJ Crystal structure of photoinhibitable Intersectin1 containing wildtype LOV2 domain Deposited 2016-02-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 404–546（143 aa）	Not recorded	FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1 M HEPES pH 7.5, 9% (w/v) PEG 8000, 9% (v/v) ethylene glycol	Resolution 2.60 Å R-free 0.281
5HZK Crystal structure of photoinhibitable Intersectin1 containing wildtype LOV2 domain in complex with Cdc42 Deposited 2016-02-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 404–546（143 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；293 K；0.1 M MES, 20% (w/v) PEG 6000	Resolution 3.30 Å R-free 0.257
5HZK Crystal structure of photoinhibitable Intersectin1 containing wildtype LOV2 domain in complex with Cdc42 Deposited 2016-02-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 404–546（143 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；293 K；0.1 M MES, 20% (w/v) PEG 6000	Resolution 3.30 Å R-free 0.257
6NTP PTP1B Domain of PTP1B-LOV2 Chimera Deposited 2019-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 407–546（140 aa） Fragment：residues 2-282	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；100 mM HEPES, 200 mM magnesium acetate, and 14% polyethylene glycol 8000, pH 7.5	Resolution 1.89 Å R-free 0.212
6NTP PTP1B Domain of PTP1B-LOV2 Chimera Deposited 2019-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 407–546（140 aa） Fragment：residues 2-282	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；100 mM HEPES, 200 mM magnesium acetate, and 14% polyethylene glycol 8000, pH 7.5	Resolution 1.89 Å R-free 0.212
7PGY Structure of light-adapted AsLOV2 wild type Deposited 2021-08-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain AAA 404–546（143 aa）	Not recorded	CA CALCIUM ION × 2 CL CHLORIDE ION × 2 GOL GLYCEROL × 7 ACT ACETATE ION × 2 EDO 1,2-ETHANEDIOL × 1 FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；298 K；0.1 M sodium acetate pH 4.6-5.0, 6-8% (w/v) PEG 4000, 30% (v/v) glycerol	Resolution 1.09 Å R-free 0.161
7PGZ Structure of dark-adapted AsLOV2 Q513L Deposited 2021-08-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain AAA 404–546（143 aa）	Mutation：Q513L	MG MAGNESIUM ION × 2 GOL GLYCEROL × 13 EDO 1,2-ETHANEDIOL × 2 FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；0.1 M sodium acetate pH 4.6-5.0, 6-8% (w/v) PEG 4000, 30% (v/v) glycerol	Resolution 0.90 Å R-free 0.139
7PH0 Structure of light-adapted AsLOV2 Q513L Deposited 2021-08-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain AAA 404–546（143 aa）	Not recorded	CL CHLORIDE ION × 1 FMN FLAVIN MONONUCLEOTIDE × 1 GOL GLYCEROL × 3 EDO 1,2-ETHANEDIOL × 2 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；0.1 M sodium acetate pH 4.6-5.0, 6-8% (w/v) PEG 4000, 30% (v/v) glycerol	Resolution 0.98 Å R-free 0.136

17 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	O49003_AVESA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AAA； PDBConstruct 4–146； UniProt 404–546

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7pgx
Deposition date deposition_date	2021-08-16
Structure title title	Structure of dark-adapted AsLOV2 wild type
Keywords keywords	flavin, light-oxygen-voltage, optogenetics, photoreceptor, phototropin, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	16.36 Å
Radius of gyration Rg (electron density) rg_electron	14.95 Å
Forward intensity I(0) i0	6874950.00
Molecular weight molecular_weight	18643.0 kDa
Excluded volume excluded_volume	23219 Å³
Envelope volume envelope_volume	26177 Å³
Hydration-shell volume shell_volume	14504 Å³
Envelope diameter envelope_diameter	52.5 Å
Shell Rg shell_rg	21.20 Å
Envelope Rg envelope_rg	15.45 Å
Shape Rg shape_rg	14.89 Å
Total Rg total_rg	16.26 Å
Total atoms total_atoms	1303
Residues n_residues	146
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	52.0 Å
Rg (real space) rg_real	16.24 Å
Rg uncertainty (real space) rg_real_error	0.21 Å
I(0) (real space) i0_real	6.8750e+06
I(0) uncertainty (real space) i0_real_error	8.4740e+04
Rg (reciprocal space) rg_reciprocal	16.25 Å
I(0) (reciprocal space) i0_reciprocal	6875000.0000
Solution quality estimate total_estimate	0.7219
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	22.0 Å
Skewness Skewness skewness	0.118
Kurtosis Kurtosis kurtosis	-0.370
Angular range angular_range	— – 0.4850 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1775000.0000
Real-space data points n_real_points	79
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.849; Stabil: 1.000; Sysdev: 0.287; Positv: 1.000; Valcen: 0.985; Smooth: 0.986

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	NPH1-1
Molecular weight formula_weight	16853.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AAA
Atom count atom_count	1877

GEFLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL

来源 Source

来源生物 organism	Avena sativa
通用名 common_name	Oat
NCBI Class编号 ncbi_taxonomy_id	4498
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 5 Entity 5 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	183

▶

8. Citations (1)

▶

Unit-cell length a length_a	35.500 Å
Unit-cell length b length_b	56.420 Å
Unit-cell length c length_c	66.660 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.001 Å
Low-resolution limit resolution_low	43.065 Å
R factor r_factor	—
R_work r_work	0.1141
R_free r_free	0.1472

fit	/app/data/saxs_computation/pg/7pgx/7pgx.fit
pddf	/app/data/pr_computation/pg/7pgx/7pgx.pr.out
profile	/app/data/saxs_computation/pg/7pgx/7pgx.dat

Structure of dark-adapted AsLOV2 wild type