7qj4

Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 5-14)

Method: ELECTRON MICROSCOPY D_max: 352.2 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin gamma-1 chain

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 28 PDB declaration: 28-meric（28） Consistent with protein copy count	Chain 1； UniProt 1–451 Chain 2； UniProt 1–451 Chain S； UniProt 1–451 Chain T； UniProt 1–451 Chain U； UniProt 1–451 Chain V； UniProt 1–451 Chain W； UniProt 1–451 Chain X； UniProt 1–451 Chain Y； UniProt 1–451 Chain Z； UniProt 1–451	Not recorded	Gamma-tubulin complex component 5 × 2 （Q96RT8） Gamma-tubulin complex component 3 × 6 （Q96CW5） Mitotic-spindle organizing protein 1 × 4 （Q08AG7） Gamma-tubulin complex component 2 × 3 （Q9BSJ2） Gamma-tubulin complex component 4 × 2 （Q9UGJ1） Gamma-tubulin complex component 6 × 1 （Q96RT7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7QJ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1Z5V Crystal structure of human gamma-tubulin bound to GTPgammaS Deposited 2005-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–449（449 aa）	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.2；277 K；Tris, KCL, PEG6000, pH 8.2, VAPOR DIFFUSION, temperature 277K	Resolution 2.71 Å R-free 0.293
1Z5W Crystal Structure of gamma-tubulin bound to GTP Deposited 2005-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–449（449 aa）	Not recorded	MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.2；277 K；Tris, KCl, PEG6000, pH 8.2, VAPOR DIFFUSION, temperature 277K	Resolution 3.00 Å R-free 0.309
3CB2 Crystal structure of human gamma-tubulin bound to GDP Deposited 2008-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–451（451 aa） Chain B 1–451（451 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；298 K；top solution: 83 mM HEPES pH 7.2, 1.2M KCl, 20% PEG6000, 1mM GDP; reservoir: 83mM HEPES pH 7.2, 0.6M KCl, 20% PEG6000, 1 mM GDP. Protein was mixed 1:1 or 1:2 with top solution, and equilibrated over the reservoir solution., VAPOR DIFFUSION, temperature 298K	Resolution 2.30 Å R-free 0.238
6V5V Structure of gamma-tubulin in the native human gamma-tubulin ring complex Deposited 2019-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain g 1–451（451 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6V6S Structure of the native human gamma-tubulin ring complex Deposited 2019-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain t 1–451（451 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
7AS4 Recombinant human gTuRC Deposited 2020-10-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain 1 1–447（447 aa） Chain 2 1–447（447 aa） Chain O 1–447（447 aa） Chain P 1–447（447 aa） Chain Q 1–447（447 aa） Chain R 1–447（447 aa） Chain S 1–447（447 aa） Chain T 1–447（447 aa） Chain U 1–447（447 aa） Chain V 1–447（447 aa） Chain W 1–447（447 aa） Chain X 1–447（447 aa） Chain Y 1–447（447 aa） Chain Z 1–447（447 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.13 Å
7QJ0 Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7QJ1 Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
7QJ2 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 5-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.60 Å
7QJ3 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 7-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain 1 1–451（451 aa） Chain 2 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.60 Å
7QJ5 Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain 1 1–451（451 aa） Chain 2 1–451（451 aa） Chain O 1–451（451 aa） Chain P 1–451（451 aa） Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ6 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, substoichiometric spokes 13-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
7QJ7 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12 substoichiometric spokes 13-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain O 1–451（451 aa） Chain P 1–451（451 aa） Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ8 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, substoichiometric spokes 1-2) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain 1 1–451（451 aa） Chain 2 1–451（451 aa） Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ9 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.10 Å
7QJA Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain O 1–451（451 aa） Chain P 1–451（451 aa） Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJB Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain 1 1–451（451 aa） Chain 2 1–451（451 aa） Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJC Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain 1 1–451（451 aa） Chain 2 1–451（451 aa） Chain O 1–451（451 aa） Chain P 1–451（451 aa） Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 16.10 Å
7QJD Structure of recombinant human gamma-Tubulin Ring Complex without actin Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain 1 1–451（451 aa） Chain 2 1–451（451 aa） Chain O 1–451（451 aa） Chain P 1–451（451 aa） Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
7QJE Structure of recombinant human gamma-Tubulin Ring Complex 4-spoked assembly intermediate (spokes 9-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
8Q62 Early closed conformation of the g-tubulin ring complex Deposited 2023-08-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain n 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.72 Å
8RX1 CryoEM structure of the gTuRC-CM1dim complex Deposited 2024-02-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain 1 1–451（451 aa） Chain 2 1–451（451 aa） Chain O 1–451（451 aa） Chain P 1–451（451 aa） Chain Q 1–451（451 aa） Chain R 1–451（451 aa） Chain S 1–451（451 aa） Chain T 1–451（451 aa） Chain U 1–451（451 aa） Chain V 1–451（451 aa） Chain W 1–451（451 aa） Chain X 1–451（451 aa） Chain Y 1–451（451 aa） Chain Z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.57 Å
8VRD Rigid body fitted model for free recombinant gamma tubulin ring complex. Deposited 2024-01-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 34 PDB declaration: 34-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain n 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
8VRJ Rigid body fitted model for gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain n 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8VRK Rigid body fitted model for refined density map of gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain n 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.50 Å
9H9P Spokes 12 and 13 of the human gamma-tubulin ring complex in complex with CDK5RAP2 and docked MZT2/GCP2-NHD module Deposited 2024-10-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain l 1–451（451 aa） Chain m 1–451（451 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
9I8G Inwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain t 1–451（451 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 22.40 Å
9I8H Outwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain t 1–451（451 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 23.20 Å
9QVM Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain n 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.80 Å
9QVN Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain n 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
9SMX CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules Deposited 2025-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 73 PDB declaration: 73-meric	Chain a 1–451（451 aa） Chain b 1–451（451 aa） Chain c 1–451（451 aa） Chain d 1–451（451 aa） Chain e 1–451（451 aa） Chain f 1–451（451 aa） Chain g 1–451（451 aa） Chain h 1–451（451 aa） Chain i 1–451（451 aa） Chain j 1–451（451 aa） Chain k 1–451（451 aa） Chain l 1–451（451 aa） Chain m 1–451（451 aa） Chain n 1–451（451 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å

31 other PDB entries and 31 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TBG1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–451； UniProt 1–451 Author chain 2； PDBConstruct 1–451； UniProt 1–451 Author chain S； PDBConstruct 1–451； UniProt 1–451 Author chain T； PDBConstruct 1–451； UniProt 1–451 Author chain U； PDBConstruct 1–451； UniProt 1–451 Author chain V； PDBConstruct 1–451； UniProt 1–451 Author chain W； PDBConstruct 1–451； UniProt 1–451 Author chain X； PDBConstruct 1–451； UniProt 1–451 Author chain Y； PDBConstruct 1–451； UniProt 1–451 Author chain Z； PDBConstruct 1–451； UniProt 1–451

Gamma-tubulin complex component 5

Homo sapiens

UniProt Q96RT8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 28 PDB declaration: 28-meric（28） Consistent with protein copy count	Chain J； UniProt 1–1024 Chain l； UniProt 1–1024	Not recorded	Tubulin gamma-1 chain × 10 （P23258） Gamma-tubulin complex component 3 × 6 （Q96CW5） Mitotic-spindle organizing protein 1 × 4 （Q08AG7） Gamma-tubulin complex component 2 × 3 （Q9BSJ2） Gamma-tubulin complex component 4 × 2 （Q9UGJ1） Gamma-tubulin complex component 6 × 1 （Q96RT7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7QJ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6L81 Crystal structure of Homo sapiens GCP5 N-terminus and Mozart1 Deposited 2019-11-04	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–119（119 aa） Fragment：N-terminus	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M ammonium iodide, 20% PEG 3350	Resolution 2.20 Å R-free 0.261
6L81 Crystal structure of Homo sapiens GCP5 N-terminus and Mozart1 Deposited 2019-11-04	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–119（119 aa） Fragment：N-terminus	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M ammonium iodide, 20% PEG 3350	Resolution 2.20 Å R-free 0.261
6V69 Structures of GCP4 and GCP5 in the native human gamma-tubulin ring complex Deposited 2019-12-04	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6V6S Structure of the native human gamma-tubulin ring complex Deposited 2019-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain J 1–1024（1024 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
7AS4 Recombinant human gTuRC Deposited 2020-10-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain J 1–1024（1024 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.13 Å
7QJ0 Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7QJ1 Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
7QJ2 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 5-12) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.60 Å
7QJ3 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 7-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.60 Å
7QJ5 Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ6 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, substoichiometric spokes 13-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
7QJ7 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12 substoichiometric spokes 13-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ8 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, substoichiometric spokes 1-2) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ9 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.10 Å
7QJA Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJB Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJC Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 16.10 Å
7QJD Structure of recombinant human gamma-Tubulin Ring Complex without actin Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain J 1–1024（1024 aa） Chain l 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
7QJE Structure of recombinant human gamma-Tubulin Ring Complex 4-spoked assembly intermediate (spokes 9-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain J 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
8Q62 Early closed conformation of the g-tubulin ring complex Deposited 2023-08-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain J 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.72 Å
8RX1 CryoEM structure of the gTuRC-CM1dim complex Deposited 2024-02-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.57 Å
8VRD Rigid body fitted model for free recombinant gamma tubulin ring complex. Deposited 2024-01-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 34 PDB declaration: 34-meric	Chain J 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
8VRJ Rigid body fitted model for gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain J 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8VRK Rigid body fitted model for refined density map of gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain J 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.50 Å
9I8G Inwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain J 1–1024（1024 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 22.40 Å
9I8H Outwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain J 1–1024（1024 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 23.20 Å
9QVM Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain J 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.80 Å
9QVN Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 1–1024（1024 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
9SMX CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules Deposited 2025-09-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 73 PDB declaration: 73-meric	Chain J 1–1024（1024 aa） Chain Z 1–1024（1024 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å

28 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GCP5_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 1–1024； UniProt 1–1024 Author chain l； PDBConstruct 1–1024； UniProt 1–1024

Gamma-tubulin complex component 3

Homo sapiens

UniProt Q96CW5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 28 PDB declaration: 28-meric（28） Consistent with protein copy count	Chain F； UniProt 1–907 Chain H； UniProt 1–907 Chain N； UniProt 1–907 Chain a； UniProt 1–907 Chain j； UniProt 1–907 Chain n； UniProt 1–907	Not recorded	Tubulin gamma-1 chain × 10 （P23258） Gamma-tubulin complex component 5 × 2 （Q96RT8） Mitotic-spindle organizing protein 1 × 4 （Q08AG7） Gamma-tubulin complex component 2 × 3 （Q9BSJ2） Gamma-tubulin complex component 4 × 2 （Q9UGJ1） Gamma-tubulin complex component 6 × 1 （Q96RT7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7QJ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6V6B Structures of GCP2 and GCP3 in the native human gamma-tubulin ring complex Deposited 2019-12-04	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6V6S Structure of the native human gamma-tubulin ring complex Deposited 2019-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain T 1–907（907 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
6X0U Structure of MZT1/GCP3-NHD and MZT1/GCP6-NHD in the gamma-TuRC lumenal bridge Deposited 2020-05-17	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7AS4 Recombinant human gTuRC Deposited 2020-10-26	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain 3 1–907（907 aa） Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.13 Å
7QJ0 Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain H 1–907（907 aa） Chain a 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7QJ1 Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain H 1–907（907 aa） Chain a 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
7QJ2 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 5-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain a 1–907（907 aa） Chain j 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.60 Å
7QJ3 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 7-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain H 1–907（907 aa） Chain N 1–907（907 aa） Chain a 1–907（907 aa） Chain n 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.60 Å
7QJ5 Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa） Chain a 1–907（907 aa） Chain f 1–907（907 aa） Chain h 1–907（907 aa） Chain j 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ6 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, substoichiometric spokes 13-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain a 1–907（907 aa） Chain h 1–907（907 aa） Chain j 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
7QJ7 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12 substoichiometric spokes 13-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain a 1–907（907 aa） Chain f 1–907（907 aa） Chain h 1–907（907 aa） Chain j 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ8 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, substoichiometric spokes 1-2) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa） Chain a 1–907（907 aa） Chain h 1–907（907 aa） Chain j 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ9 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain a 1–907（907 aa） Chain h 1–907（907 aa） Chain j 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.10 Å
7QJA Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain a 1–907（907 aa） Chain f 1–907（907 aa） Chain h 1–907（907 aa） Chain j 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJB Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa） Chain a 1–907（907 aa） Chain h 1–907（907 aa） Chain j 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJC Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa） Chain a 1–907（907 aa） Chain f 1–907（907 aa） Chain h 1–907（907 aa） Chain j 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 16.10 Å
7QJD Structure of recombinant human gamma-Tubulin Ring Complex without actin Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa） Chain a 1–907（907 aa） Chain f 1–907（907 aa） Chain h 1–907（907 aa） Chain j 1–907（907 aa） Chain n 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
8Q62 Early closed conformation of the g-tubulin ring complex Deposited 2023-08-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.72 Å
8RX1 CryoEM structure of the gTuRC-CM1dim complex Deposited 2024-02-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain N 1–907（907 aa） Chain b 1–907（907 aa） Chain n 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.57 Å
8VRD Rigid body fitted model for free recombinant gamma tubulin ring complex. Deposited 2024-01-21	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 34 PDB declaration: 34-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa） Chain O 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
8VRJ Rigid body fitted model for gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain 5 1–907（907 aa） Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8VRK Rigid body fitted model for refined density map of gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain 5 1–907（907 aa） Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.50 Å
9I8G Inwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain R 1–907（907 aa） Chain T 1–907（907 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 22.40 Å
9I8H Outwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain R 1–907（907 aa） Chain T 1–907（907 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 23.20 Å
9QVM Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa） Chain r 1–907（907 aa） Chain s 1–907（907 aa） Chain t 1–907（907 aa） Chain u 1–907（907 aa） Chain v 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.80 Å
9QVN Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa） Chain r 1–907（907 aa） Chain s 1–907（907 aa） Chain t 1–907（907 aa） Chain u 1–907（907 aa） Chain v 1–907（907 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
9SMX CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules Deposited 2025-09-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 73 PDB declaration: 73-meric	Chain 3 1–907（907 aa） Chain B 1–907（907 aa） Chain D 1–907（907 aa） Chain F 1–907（907 aa） Chain H 1–907（907 aa） Chain N 1–907（907 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å

27 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GCP3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 1–907； UniProt 1–907 Author chain H； PDBConstruct 1–907； UniProt 1–907 Author chain N； PDBConstruct 1–907； UniProt 1–907 Author chain a； PDBConstruct 1–907； UniProt 1–907 Author chain j； PDBConstruct 1–907； UniProt 1–907 Author chain n； PDBConstruct 1–907； UniProt 1–907

Mitotic-spindle organizing protein 1

Homo sapiens

UniProt Q08AG7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 28 PDB declaration: 28-meric（28） Consistent with protein copy count	Chain b； UniProt 1–82 Chain k； UniProt 1–82 Chain m； UniProt 1–82 Chain o； UniProt 1–82	Not recorded	Tubulin gamma-1 chain × 10 （P23258） Gamma-tubulin complex component 5 × 2 （Q96RT8） Gamma-tubulin complex component 3 × 6 （Q96CW5） Gamma-tubulin complex component 2 × 3 （Q9BSJ2） Gamma-tubulin complex component 4 × 2 （Q9UGJ1） Gamma-tubulin complex component 6 × 1 （Q96RT7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7QJ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6L81 Crystal structure of Homo sapiens GCP5 N-terminus and Mozart1 Deposited 2019-11-04	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–82（82 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M ammonium iodide, 20% PEG 3350	Resolution 2.20 Å R-free 0.261
6L81 Crystal structure of Homo sapiens GCP5 N-terminus and Mozart1 Deposited 2019-11-04	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–82（82 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M ammonium iodide, 20% PEG 3350	Resolution 2.20 Å R-free 0.261
6M33 Crystal structure of Homo Sapian GCP6 N-terminus and Mozart1 Deposited 2020-03-02	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–82（82 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；3.5M Ammonium chloride, 0.1M Bis-Tris propane p.H 7.0	Resolution 3.29 Å R-free 0.298
6X0U Structure of MZT1/GCP3-NHD and MZT1/GCP6-NHD in the gamma-TuRC lumenal bridge Deposited 2020-05-17	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–82（82 aa） Chain C 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7AS4 Recombinant human gTuRC Deposited 2020-10-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain 5 1–82（82 aa） Chain 6 1–82（82 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.13 Å
7QJ0 Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain b 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7QJ1 Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain b 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
7QJ2 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 5-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain b 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.60 Å
7QJ3 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 7-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain b 1–82（82 aa） Chain m 1–82（82 aa） Chain o 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.60 Å
7QJ5 Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain b 1–82（82 aa） Chain d 1–82（82 aa） Chain g 1–82（82 aa） Chain i 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ6 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, substoichiometric spokes 13-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain b 1–82（82 aa） Chain d 1–82（82 aa） Chain i 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
7QJ7 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12 substoichiometric spokes 13-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain b 1–82（82 aa） Chain d 1–82（82 aa） Chain g 1–82（82 aa） Chain i 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ8 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, substoichiometric spokes 1-2) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain b 1–82（82 aa） Chain d 1–82（82 aa） Chain i 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ9 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain b 1–82（82 aa） Chain d 1–82（82 aa） Chain i 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.10 Å
7QJA Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain b 1–82（82 aa） Chain d 1–82（82 aa） Chain g 1–82（82 aa） Chain i 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJB Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain b 1–82（82 aa） Chain d 1–82（82 aa） Chain i 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJC Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain b 1–82（82 aa） Chain d 1–82（82 aa） Chain g 1–82（82 aa） Chain i 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 16.10 Å
7QJD Structure of recombinant human gamma-Tubulin Ring Complex without actin Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain b 1–82（82 aa） Chain d 1–82（82 aa） Chain g 1–82（82 aa） Chain i 1–82（82 aa） Chain k 1–82（82 aa） Chain m 1–82（82 aa） Chain o 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
8RX1 CryoEM structure of the gTuRC-CM1dim complex Deposited 2024-02-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain a 1–82（82 aa） Chain c 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.57 Å
8VRD Rigid body fitted model for free recombinant gamma tubulin ring complex. Deposited 2024-01-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 34 PDB declaration: 34-meric	Chain Q 1–82（82 aa） Chain R 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
8VRJ Rigid body fitted model for gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain 7 1–82（82 aa） Chain 8 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8VRK Rigid body fitted model for refined density map of gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain 7 1–82（82 aa） Chain 8 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.50 Å
9I8G Inwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain Q 1–82（82 aa） Chain S 1–82（82 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 22.40 Å
9I8H Outwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain Q 1–82（82 aa） Chain S 1–82（82 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 23.20 Å
9QVM Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain O 1–82（82 aa） Chain P 1–82（82 aa） Chain Q 1–82（82 aa） Chain R 1–82（82 aa） Chain S 1–82（82 aa） Chain T 1–82（82 aa） Chain U 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.80 Å
9QVN Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain O 1–82（82 aa） Chain P 1–82（82 aa） Chain Q 1–82（82 aa） Chain R 1–82（82 aa） Chain S 1–82（82 aa） Chain T 1–82（82 aa） Chain U 1–82（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
9SMX CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules Deposited 2025-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 73 PDB declaration: 73-meric	Chain 4 1–82（82 aa） Chain 6 1–82（82 aa） Chain Y 1–82（82 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å

26 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MZT1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain b； PDBConstruct 1–82； UniProt 1–82 Author chain k； PDBConstruct 1–82； UniProt 1–82 Author chain m； PDBConstruct 1–82； UniProt 1–82 Author chain o； PDBConstruct 1–82； UniProt 1–82

Gamma-tubulin complex component 2

Homo sapiens

UniProt Q9BSJ2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 28 PDB declaration: 28-meric（28） Consistent with protein copy count	Chain E； UniProt 1–902 Chain G； UniProt 1–902 Chain M； UniProt 1–902	Not recorded	Tubulin gamma-1 chain × 10 （P23258） Gamma-tubulin complex component 5 × 2 （Q96RT8） Gamma-tubulin complex component 3 × 6 （Q96CW5） Mitotic-spindle organizing protein 1 × 4 （Q08AG7） Gamma-tubulin complex component 4 × 2 （Q9UGJ1） Gamma-tubulin complex component 6 × 1 （Q96RT7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7QJ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6V6B Structures of GCP2 and GCP3 in the native human gamma-tubulin ring complex Deposited 2019-12-04	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–930（930 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6V6S Structure of the native human gamma-tubulin ring complex Deposited 2019-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain A 1–930（930 aa） Chain C 1–930（930 aa） Chain E 1–930（930 aa） Chain G 1–930（930 aa） Chain M 1–930（930 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
6X0V Structure of MZT2/GCP-NHD and CDK5Rap2 at position 13 of the gamma-TuRC Deposited 2020-05-17	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 1–930（930 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
7AS4 Recombinant human gTuRC Deposited 2020-10-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.13 Å
7QJ0 Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain G 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7QJ1 Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain G 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
7QJ2 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 5-12) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain E 1–902（902 aa） Chain G 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.60 Å
7QJ3 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 7-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.60 Å
7QJ5 Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ6 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, substoichiometric spokes 13-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
7QJ7 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12 substoichiometric spokes 13-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ8 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, substoichiometric spokes 1-2) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ9 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.10 Å
7QJA Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJB Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJC Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 16.10 Å
7QJD Structure of recombinant human gamma-Tubulin Ring Complex without actin Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
8Q62 Early closed conformation of the g-tubulin ring complex Deposited 2023-08-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.72 Å
8RX1 CryoEM structure of the gTuRC-CM1dim complex Deposited 2024-02-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain M 1–902（902 aa） Chain f 1–902（902 aa） Chain k 1–902（902 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.57 Å
8VRD Rigid body fitted model for free recombinant gamma tubulin ring complex. Deposited 2024-01-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 34 PDB declaration: 34-meric	Chain A 1–930（930 aa） Chain C 1–930（930 aa） Chain E 1–930（930 aa） Chain G 1–930（930 aa） Chain M 1–930（930 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
8VRJ Rigid body fitted model for gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 1–930（930 aa） Chain C 1–930（930 aa） Chain E 1–930（930 aa） Chain G 1–930（930 aa） Chain M 1–930（930 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8VRK Rigid body fitted model for refined density map of gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 1–930（930 aa） Chain C 1–930（930 aa） Chain E 1–930（930 aa） Chain G 1–930（930 aa） Chain M 1–930（930 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.50 Å
9H9P Spokes 12 and 13 of the human gamma-tubulin ring complex in complex with CDK5RAP2 and docked MZT2/GCP2-NHD module Deposited 2024-10-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain M 1–930（930 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
9I8G Inwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 22.40 Å
9I8H Outwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain E 1–902（902 aa） Chain G 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 23.20 Å
9QVM Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 1–930（930 aa） Chain C 1–930（930 aa） Chain E 1–930（930 aa） Chain G 1–930（930 aa） Chain M 1–930（930 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.80 Å
9QVN Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–930（930 aa） Chain C 1–930（930 aa） Chain E 1–930（930 aa） Chain G 1–930（930 aa） Chain M 1–930（930 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
9SMX CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules Deposited 2025-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 73 PDB declaration: 73-meric	Chain A 1–902（902 aa） Chain C 1–902（902 aa） Chain CN 1–902（902 aa） Chain E 1–902（902 aa） Chain EN 1–902（902 aa） Chain G 1–902（902 aa） Chain GN 1–902（902 aa） Chain M 1–902（902 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å

28 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GCP2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–902； UniProt 1–902 Author chain G； PDBConstruct 1–902； UniProt 1–902 Author chain M； PDBConstruct 1–902； UniProt 1–902

Gamma-tubulin complex component 4

Homo sapiens

UniProt Q9UGJ1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 28 PDB declaration: 28-meric（28） Consistent with protein copy count	Chain I； UniProt 1–667 Chain K； UniProt 1–667	Not recorded	Tubulin gamma-1 chain × 10 （P23258） Gamma-tubulin complex component 5 × 2 （Q96RT8） Gamma-tubulin complex component 3 × 6 （Q96CW5） Mitotic-spindle organizing protein 1 × 4 （Q08AG7） Gamma-tubulin complex component 2 × 3 （Q9BSJ2） Gamma-tubulin complex component 6 × 1 （Q96RT7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7QJ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3RIP Crystal Structure of human gamma-tubulin complex protein 4 (GCP4) Deposited 2011-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–666（666 aa）	Not recorded	MRD (4R)-2-METHYLPENTANE-2,4-DIOL × 1 GOL GLYCEROL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；285 K；8-10% MPD (2-methyl-2,4-pentanediol), 0-20% glycerol (w/v), 300-400 mM Tris-Hcl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.30 Å R-free 0.260
3RIP Crystal Structure of human gamma-tubulin complex protein 4 (GCP4) Deposited 2011-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–666（666 aa）	Not recorded	MRD (4R)-2-METHYLPENTANE-2,4-DIOL × 2 GOL GLYCEROL × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；285 K；8-10% MPD (2-methyl-2,4-pentanediol), 0-20% glycerol (w/v), 300-400 mM Tris-Hcl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.30 Å R-free 0.260
6V69 Structures of GCP4 and GCP5 in the native human gamma-tubulin ring complex Deposited 2019-12-04	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6V6S Structure of the native human gamma-tubulin ring complex Deposited 2019-12-05	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
7AS4 Recombinant human gTuRC Deposited 2020-10-26	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.13 Å
7QJ0 Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7QJ1 Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
7QJ2 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 5-12) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.60 Å
7QJ3 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 7-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.60 Å
7QJ5 Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ6 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, substoichiometric spokes 13-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
7QJ7 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12 substoichiometric spokes 13-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ8 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, substoichiometric spokes 1-2) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ9 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.10 Å
7QJA Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJB Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJC Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 16.10 Å
7QJD Structure of recombinant human gamma-Tubulin Ring Complex without actin Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
7QJE Structure of recombinant human gamma-Tubulin Ring Complex 4-spoked assembly intermediate (spokes 9-12) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
8Q62 Early closed conformation of the g-tubulin ring complex Deposited 2023-08-10	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.72 Å
8RX1 CryoEM structure of the gTuRC-CM1dim complex Deposited 2024-02-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.57 Å
8VRD Rigid body fitted model for free recombinant gamma tubulin ring complex. Deposited 2024-01-21	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 34 PDB declaration: 34-meric	Chain I 1–666（666 aa） Chain K 1–666（666 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
8VRJ Rigid body fitted model for gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain I 1–666（666 aa） Chain K 1–666（666 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8VRK Rigid body fitted model for refined density map of gamma tubulin ring complex capped microtubule Deposited 2024-01-22	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain I 1–666（666 aa） Chain K 1–666（666 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.50 Å
9I8G Inwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 22.40 Å
9I8H Outwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 23.20 Å
9QVM Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.80 Å
9QVN Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex Deposited 2025-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
9SMX CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules Deposited 2025-09-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 73 PDB declaration: 73-meric	Chain I 1–667（667 aa） Chain K 1–667（667 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å

28 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GCP4_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain I； PDBConstruct 1–667； UniProt 1–667 Author chain K； PDBConstruct 1–667； UniProt 1–667

Gamma-tubulin complex component 6

Homo sapiens

UniProt Q96RT7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 28 PDB declaration: 28-meric（28） Consistent with protein copy count	Chain L； UniProt 1–1819	Not recorded	Tubulin gamma-1 chain × 10 （P23258） Gamma-tubulin complex component 5 × 2 （Q96RT8） Gamma-tubulin complex component 3 × 6 （Q96CW5） Mitotic-spindle organizing protein 1 × 4 （Q08AG7） Gamma-tubulin complex component 2 × 3 （Q9BSJ2） Gamma-tubulin complex component 4 × 2 （Q9UGJ1）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 9.00 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7QJ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6M33 Crystal structure of Homo Sapian GCP6 N-terminus and Mozart1 Deposited 2020-03-02	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–119（119 aa） Fragment：N-terminus	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；3.5M Ammonium chloride, 0.1M Bis-Tris propane p.H 7.0	Resolution 3.29 Å R-free 0.298
6V6C Structure of GCP6 in the native human gamma-tubulin ring complex Deposited 2019-12-04	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain L 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6V6S Structure of the native human gamma-tubulin ring complex Deposited 2019-12-05	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain L 1–1819（1819 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
6X0U Structure of MZT1/GCP3-NHD and MZT1/GCP6-NHD in the gamma-TuRC lumenal bridge Deposited 2020-05-17	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7AS4 Recombinant human gTuRC Deposited 2020-10-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain 4 1–1819（1819 aa） Chain L 1–1819（1819 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.13 Å
7QJ0 Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain L 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.32 Å
7QJ1 Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain L 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å
7QJ2 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 5-12) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain L 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.60 Å
7QJ3 Structure of recombinant human gamma-Tubulin Ring Complex 8-spoked assembly intermediate (spokes 7-14) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 22 PDB declaration: 22-meric	Chain L 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.60 Å
7QJ5 Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain L 1–1819（1819 aa） Chain c 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ6 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, substoichiometric spokes 13-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain L 1–1819（1819 aa） Chain c 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
7QJ7 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12 substoichiometric spokes 13-14) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain L 1–1819（1819 aa） Chain c 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ8 Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, substoichiometric spokes 1-2) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain L 1–1819（1819 aa） Chain c 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.70 Å
7QJ9 Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 3-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 31 PDB declaration: 31-meric	Chain L 1–1819（1819 aa） Chain c 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.10 Å
7QJA Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 1-12, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 37 PDB declaration: 37-meric	Chain L 1–1819（1819 aa） Chain c 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJB Structure of recombinant human gamma-Tubulin Ring Complex 12-spoked assembly intermediate (spokes 3-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain L 1–1819（1819 aa） Chain c 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.20 Å
7QJC Structure of recombinant human gamma-Tubulin Ring Complex (spokes 1-14, homogeneous dataset) Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 41 PDB declaration: 41-meric	Chain L 1–1819（1819 aa） Chain c 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 16.10 Å
7QJD Structure of recombinant human gamma-Tubulin Ring Complex without actin Deposited 2021-12-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain L 1–1819（1819 aa） Chain c 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.10 Å
7QJE Structure of recombinant human gamma-Tubulin Ring Complex 4-spoked assembly intermediate (spokes 9-12) Deposited 2021-12-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain L 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
8Q62 Early closed conformation of the g-tubulin ring complex Deposited 2023-08-10	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain L 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.72 Å
8RX1 CryoEM structure of the gTuRC-CM1dim complex Deposited 2024-02-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain L 1–1819（1819 aa） Chain d 1–1819（1819 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.57 Å
9H9P Spokes 12 and 13 of the human gamma-tubulin ring complex in complex with CDK5RAP2 and docked MZT2/GCP2-NHD module Deposited 2024-10-31	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain L 1–1819（1819 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
9I8G Inwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain L 1–1819（1819 aa） Chain P 1–1819（1819 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 22.40 Å
9I8H Outwards conformation' of the human gamma-TuRC from purified centrosomes obtained by rigid body docking Deposited 2025-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain L 1–1819（1819 aa） Chain P 1–1819（1819 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 23.20 Å
9SMX CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules Deposited 2025-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 73 PDB declaration: 73-meric	Chain 5 1–1819（1819 aa） Chain L 1–1819（1819 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å

25 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GCP6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain L； PDBConstruct 1–1819； UniProt 1–1819

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7qj4
Deposition date deposition_date	2021-12-16
Structure title title	Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 5-14)
Keywords keywords	Intermediate, Assembly, Complex, CYTOSOLIC PROTEIN; CYTOSOLIC PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	117.40 Å
Forward intensity I(0) i0	20147700000.00
Molecular weight molecular_weight	1238600.0 kDa
Excluded volume excluded_volume	1559900 Å³
Envelope volume envelope_volume	3349900 Å³
Hydration-shell volume shell_volume	251060 Å³
Envelope diameter envelope_diameter	377.1 Å
Shell Rg shell_rg	109.30 Å
Envelope Rg envelope_rg	107.10 Å
Shape Rg shape_rg	117.30 Å
Total Rg total_rg	117.40 Å
Total atoms total_atoms	87259
Residues n_residues	10766
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	352.2 Å
Rg (real space) rg_real	119.70 Å
Rg uncertainty (real space) rg_real_error	1.49 Å
I(0) (real space) i0_real	1.9760e+10
I(0) uncertainty (real space) i0_real_error	3.8620e+08
Rg (reciprocal space) rg_reciprocal	110.30 Å
I(0) (reciprocal space) i0_reciprocal	19580000000.0000
Solution quality estimate total_estimate	0.9002
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	108.4 Å
Skewness Skewness skewness	0.229
Kurtosis Kurtosis kurtosis	-0.847
Angular range angular_range	— – 0.0650 Å⁻¹
Current regularization parameter α current_alpha	2.3000
Highest regularization parameter α highest_alpha	416700000.0000
Real-space data points n_real_points	14
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.997; Stabil: 0.918; Sysdev: 1.000; Positv: 1.000; Valcen: 0.966; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Tubulin gamma-1 chain
Molecular weight formula_weight	51227.8 kDa
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,S,T,U,V,W,X,Y,Z
Atom count atom_count	87259

MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 2 Entity 2 polymer

Description description	Gamma-tubulin complex component 5
Molecular weight formula_weight	118467.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,J

MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSIKEIKTDAHYSILSLLLCLSDSPSNSSYVETPRNKEVEKKDDFDWGKYLMEDEEMDIGPYMDTPNWSEESEEENDQQPLSREDSGIQVDRTPLEEQDQNRKLDPCISWKDEPDDRSWLEHHVVHQYWTARPSQFPHSLHLHSNLAAVWDQHLYSSDPLYVPDDRVLVTETQVIRETLWLLSGVKKLFIFQLIDGKVTVRNNIIVTHLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESMLPGSGSVPKKSTEAPFRTYQAFMWALYKYFISFKEELAEIEKCIINNDTTITLAIVVDKLAPRLSQLKVLHKVFSTGVAEVPPDTRNVVRASHLLNTLYKAILEYDNVGEASEQTVSLLFSLWVETVRPYLQTVDEWIVHGHLWDGAREFIIQRNKNVPVNHRDFWYATYTLYSVSEKTENEEKMSDNASASSGSDQGPSSRQHTMVSFLKPVLKQIIMAGKSMQLLKNLQCAESTTCQAGARDAERKSLYTLFLESVQSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDFHEKFAGGDVCVDRSSESVTCQTFELTLRSCLYPHIDKQYLDCCGNLMQTLKKDYRLVEYLQAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLPVHILDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDVLLFGELVSTAEKPRLKEGLIHEQDTVAQFGPQKEPVRQQIHRMFLLRVKLMHFVNSLHNYIMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNLALMFADGWQAGLGTWRMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSLMAGMEQS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 3 Entity 3 polymer

Description description	Gamma-tubulin complex component 3
Molecular weight formula_weight	103710.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n,F,H,N,j,a

MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLRVFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHEVFLDTIISRCLLDSDSRALLNQLRAVFDQIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESIPKMCSQLRILTHFYQGIVQQFLVLLTTSSDESLRFLSFRLDFNEHYKAREPRLRVSLGTRGRRSSHT

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 4 Entity 4 polymer

Description description	Mitotic-spindle organizing protein 1
Molecular weight formula_weight	8485.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o,m,k,b

MASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 5 Entity 5 polymer

Description description	Gamma-tubulin complex component 2
Molecular weight formula_weight	102667.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G,M

MSEFRIHHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTPEDFLKKYDELKSKNTRNLDPLVYLLSKLTEDKETLQYLQQNAKERAELAAAAVGSSTTSINVPAAASKISMQELEELRKQLGSVATGSTLQQSLELKRKMLRDKQNKKNSGQHLPIFPAWVYERPALIGDFLIGAGISTDTALPIGTLPLASQESAVVEDLLYVLVGVDGRYVSAQPLAGRQSRTFLVDPNLDLSIRELVHRILPVAASYSAVTRFIEEKSSFEYGQVNHALAAAMRTLVKEHLILVSQLEQLHRQGLLSLQKLWFYIQPAMRTMDILASLATSVDKGECLGGSTLSLLHDRSFSYTGDSQAQELCLYLTKAASAPYFEVLEKWIYRGIIHDPYSEFMVEEHELRKERIQEDYNDKYWDQRYTIVQQQIPSFLQKMADKILSTGKYLNVVRECGHDVTCPVAKEIIYTLKERAYVEQIEKAFNYASKVLLDFLMEEKELVAHLRSIKRYFLMDQGDFFVHFMDLAEEELRKPVEDITPPRLEALLELALRMSTANTDPFKDDLKIDLMPHDLITQLLRVLAIETKQEKAMAHADPTELALSGLEAFSFDYIVKWPLSLIINRKALTRYQMLFRHMFYCKHVERQLCSVWISNKTAKQHSLHSAQWFAGAFTLRQRMLNFVQNIQYYMMFEVMEPTWHILEKNLKSASNIDDVLGHHTGFLDTCLKDCMLTNPELLKVFSKLMSVCVMFTNCMQKFTQSMKLDGELGGQTLEHSTVLGLPAGAEERARKELARKHLAEHADTVQLVSGFEATINKFDKNFSAHLLDLLARLSIYSTSDCEHGMASVISRLDFNGFYTERLERLSAERSQKATPQVPVLRGPPAPAPRVAVTAQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 6 Entity 6 polymer

Description description	Gamma-tubulin complex component 4
Molecular weight formula_weight	76180.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,K

MIHELLLALSGYPGSIFTWNKRSGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIEQYTGHVQQQDHHPSQQGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLGDPHLSISHVNYFLDQFQLLFPSVMVVVEQIKSQKIHGCQILETVYKHSCGGLPPVRSALEKILAVCHGVMYKQLSAWMLHGLLLDQHEEFFIKQGPSSGNVSAQPEEDEEDLGIGGLTGKQLRELQDLRLIEEENMLAPSLKQFSLRVEILPSYIPVRVAEKILFVGESVQMFENQNVNLTRKGSILKNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLLGRGELFQAFIDTAQHMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIEYHGKEHKADATQAREGPSRETSPREAPASGWAALGLSYKVQWPLHILFTPAVLEKYNVVFKYLLSVRRVQAELQHCWALQMQRKHLKSNQTDAIKWRLRNHMAFLVDNLQYYLQVDVLESQFSQLLHQINSTRDFESIRLAHDHFLSNLLAQSFILLKPVFHCLNEILDLCHSFCSLVSQNLGPLDERGAAQLSILVKGFSRQSSLLFKILSSVRNHQINSDLAQLLLRLDYNKYYTQAGGTLGSFGM

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 7 Entity 7 polymer

Description description	Gamma-tubulin complex component 6
Molecular weight formula_weight	200733.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MASITQLFDDLCEALLPAAKTHLGQRSVNRKRAKRSLKKVAYNALFTNLFQDETQQLQPDMSKLPARNKILMLSFDLRVGGLGPKADRLEELVEELEAAPCCPLLEVGSVLDLLVQLAGSGPPQVLPRKRDYFLNNKHVGRNVPYSGYDCDDLSVFEMDVQSLISREECLCHSMIQETLQVMEAAPGTGLPTVGLFSFGDPCGDRFERDTRVSLFGALVHSRTYDMDVRLGLPPVPDNADLSGLAIKVPPSVDQWEDEGFQSASNLTPDSQSEPSVTPDVDLWEAALTYEASKRRCWERVGCPPGHREEPYLTEAGRDAFDKFCRLHQGELQLLAGGVLQAPQPVLVKECELVKDVLNVLIGVVSATFSLCQPAQAFVVKRGVHVSGASPESISSLLSEVAEYGTCYTRLSHFSLQPVLDSLYSKGLVFQAFTSGLRRYLQYYRACVLSTPPTLSLLTIGFLFKKLGRQLRYLAELCGVGAVLPGTCGGGPRAAFPTGVKLLSYLYQEALHNCSNEHYPVLLSLLKTSCEPYTRFIHDWVYSGVFRDAYGEFMIQVNHEYLSFRDKLYWTHGYVLISKEVEDCVPVFLKHIAHDIYVCGKTINLLKLCCPRHYLCWSDVPVPRISVIFSLEELKEIEKDCAVYVGRMERVARHSSVSKEEKELRMEIAKQELIAHAREAASRVLSALSDRQMSERMALDARKREQFQRLKEQFVKDQERRQAARQEELDDDFSYARELRDRERRLKSLEEELERKARQALVDHYSKLSAEAARREQKALWRIQRHRLESARLRFLLEDEKHIQEMLKAVSEAHQPQEPPDVLLSVHPQVTSPGPEHPEGGQGCDSGSAEQHSPAWDGWNRPGLLTPQPLKPLAVGAGGRGLQQAEGARPFSDSLSIGDFLPVGPGAEPSVQTGMVPLLEVALQTINLDLPPSAPGEAPAAASTQPSRPQEYDFSTVLRPAVATSPAPGPLQAAECSLGSSGLQLWEDSCGKMDACGSASRETLLPSHPPRRAALEEGSSQPTERLFGQVSGGGLPTGDYASEIAPTRPRWNTHGHVSDASIRVGENVSDVAPTQPRWNTHGHVSNASISLGESVSDVAPTRPRWNIHGHVSNASIRVGENVSDVAPTRPRWNTHGHVSNASIRVGENVSDVAPTRPRWNTHGHVSDASISLGESVSDMAPARPRWNTHGHVSDASISLGESVSDMAPTRPRWNTHGHVSDTSIRVGENVSDVAPIRSRCNTHGHVSDASISLGEPVSDVVSTRPRWNTHVPIPPPHMVLGALSPEAEPNTPRPQQSPPGHTSQSALSLGAQSTVLDCGPRLPVEVGPSLSSPSSGCGEGSISVGENVSDVAPTQPWWPNTPGDSVSEELGPGRSGDTEDLSPNWPLNSQEDTAAQSSPGRGEEAEASAAEAQGGEQAYLAGLAGQYHLERYPDSYESMSEPPIAHLLRPVLPRAFAFPVDPQVQSAADETAVQLSELLTLPVLMKRSITAPLAAHISLVNKAAVDYFFVELHLEAHYEALRHFLLMEDGEFAQSLSDLLFEKLGAGQTPGELLNPLVLNSVLSKALQCSLHGDTPHASNLSLALKYLPEVFAPNAPDVLSCLELRYKVDWPLNIVITEGCVSKYSGVFSFLLQLKLMMWALKDVCFHLKRTALLSHMAGSVQFRQLQLFKHEMQHFVKVIQGYIANQILHVTWCEFRARLATVGDLEEIQRAHAEYLHKAVFRGLLTEKAAPVMNVIHSIFSLVLKFRSQLISQAWGPPGGPRGAEHPNFALMQQSYNTFKYYSHFLFKVVTKLVNRGYQPHLEDFLLRINFNNYYQDA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	9.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	6097

fit	/app/data/saxs_computation/qj/7qj4/7qj4.fit
pddf	/app/data/pr_computation/qj/7qj4/7qj4.pr.out
profile	/app/data/saxs_computation/qj/7qj4/7qj4.dat

Structure of recombinant human gamma-Tubulin Ring Complex 10-spoked assembly intermediate (spokes 5-14)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin gamma-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

Gamma-tubulin complex component 5

State in the Current Structure

Other States of the Same Protein in the Database

Gamma-tubulin complex component 3

State in the Current Structure

Other States of the Same Protein in the Database

Mitotic-spindle organizing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Gamma-tubulin complex component 2

State in the Current Structure

Other States of the Same Protein in the Database

Gamma-tubulin complex component 4

State in the Current Structure

Other States of the Same Protein in the Database

Gamma-tubulin complex component 6

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

来源 Source

Entity 7 Entity 7 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)