7qoo

Structure of the human inner kinetochore CCAN complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Centromere protein C

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPC_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–544； UniProt 1–544

Centromere protein H

Homo sapiens

UniProt Q9H3R5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPH_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–247； UniProt 1–247

Centromere protein I

Homo sapiens

UniProt Q92674

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPI_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–756； UniProt 1–756

Centromere protein K

Homo sapiens

UniProt Q9BS16

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPK_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–269； UniProt 1–269

Centromere protein L

Homo sapiens

UniProt Q8N0S6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPL_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–344； UniProt 1–344

Centromere protein M

Homo sapiens

UniProt Q9NSP4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPM_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–180； UniProt 1–180

Centromere protein N

Homo sapiens

UniProt Q96H22

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPN_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain N； PDBConstruct 1–339； UniProt 1–339

Centromere protein O

Homo sapiens

UniProt Q9BU64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPO_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain O； PDBConstruct 1–300； UniProt 1–300

Centromere protein P

Homo sapiens

UniProt Q6IPU0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPP_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain P； PDBConstruct 1–288； UniProt 1–288

Centromere protein U

Homo sapiens

UniProt Q71F23

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPU_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–418； UniProt 1–418

Centromere protein Q

Homo sapiens

UniProt Q7L2Z9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPQ_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Q； PDBConstruct 1–268； UniProt 1–268

Centromere protein R

Homo sapiens

UniProt Q13352

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein T × 1 （Q96BT3） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPR_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain R； PDBConstruct 1–177； UniProt 1–177

Centromere protein T

Homo sapiens

UniProt Q96BT3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein W × 1 （Q5EE01） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPT_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain T； PDBConstruct 1–561； UniProt 1–561

Centromere protein W

Homo sapiens

UniProt Q5EE01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Centromere protein C × 1 （Q03188） Centromere protein H × 1 （Q9H3R5） Centromere protein I × 1 （Q92674） Centromere protein K × 1 （Q9BS16） Centromere protein L × 1 （Q8N0S6） Centromere protein M × 1 （Q9NSP4） Centromere protein N × 1 （Q96H22） Centromere protein O × 1 （Q9BU64） Centromere protein P × 1 （Q6IPU0） Centromere protein U × 1 （Q71F23） Centromere protein Q × 1 （Q7L2Z9） Centromere protein R × 1 （Q13352） Centromere protein T × 1 （Q96BT3） Unknown protein × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPW_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain W； PDBConstruct 1–88； UniProt 1–88

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7qoo
Deposition date deposition_date	2021-12-24
Structure title title	Structure of the human inner kinetochore CCAN complex
Keywords keywords	INNER KINETOCHORE, CCAN, COMPLEX, DNA BINDING PROTEIN, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7qoo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7qoo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7qoo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.13 Å
Rg (electron density)	60.87 Å
Total Rg	61.06 Å
Atom count	24085
Residues	2973
Excluded volume	433540 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7qoo__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	Centromere protein C
Molecular weight formula_weight	61856.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	24085

MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTCIQSPSKECQKSHPKSVPVSSKKKEASLQFVVEPSEATNRSVQAHEVHQKILATDVSSKNTPDSKKISSRNINDHHSEADEEFYLSVGSPSVLLDAKTSVSQNVIPSSAQKRETYTFENSVNMLPSSTEVSVKTKKRLNFDDKVMLKKIEIDNKVSDEEDKTSEGQERKPSGSSQNRIRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIVRHAATAPPHSCPPDDTKLIEDEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALLQGRKSREKHHNILPKTLANDKHSHKPHPVETSQPSDKTVLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQKQRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRKDKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEESPVYSNS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Centromere protein H
Molecular weight formula_weight	28520.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Centromere protein I
Molecular weight formula_weight	86820.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVNTRILKCMIPATVISEDSVVKAVSWLCVGKCSGSTKVLFYRWLVAMFDFIDRKEQINLLYGFFFASLQDDALCPYVCHLLYLLTKKENVKPFRVRKLLDLQAKMGMQPHLQALLSLYKFFAPALISVSLPVRKKIYFKNSENLWKTALLAVKQRNRGPSPEPLKLMLGPANVRPLKRKWNSLSVIPVLNSSSYTKECGKKEMSLSDCLNRSGSFPLEQLQSFPQLLQNIHCLELPSQMGSVLNNSLLLHYINCVRDEPVLLRFYYWLSQTLQEECIWYKVNNYEHGKEFTNFLDTIIRAECFLQEGFYSCEAFLYKSLPLWDGLCCRSQFLQLVSWIPFSSFSEVKPLLFDHLAQLFFTSTIYFKCSVLQSLKELLQNWLLWLSMDIHMKPVTNSPLETTLGGSMNSVSKLIHYVGWLSTTAMRLESNNTFLLHFILDFYEKVCDIYINYNLPLVVLFPPGIFYSALLSLDTSILNQLCFIMHRYRKNLTAAKKNELVQKTKSEFNFSSKTYQEFNHYLTSMVGCLWTSKPFGKGIYIDPEILEKTGVAEYKNSLNVVHHPSFLSYAVSFLLQESPEERTVNVSSIRGKKWSWYLDYLFSQGLQGLKLFIRSSVHHSSIPRAEGINCNNQY

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Centromere protein K
Molecular weight formula_weight	31696.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNQEDLDPDSTTDVGDVTNTEEELIRECEEMWKDMEECQNKLSLIGTETLTDSNAQLSLLIMQVKCLTAELSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLNVLHSELKNKVETFSESRIFNELKTKMLNIKEYKEKLLSTLGEFLEDHFPLPDRSVKKKKKNIQESSVNLITLHEMLEILINRLFDVPHDPYVKISDSFWPPYVELLLRNGIALRHPEDPTRIRLEAFHQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Centromere protein L
Molecular weight formula_weight	39039.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHKQWTLYSLTPLYKFSYSNLKEYSRLLNAFIVAEKQKGLAVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQIVSKSQLPSENREGKVLWTGWFCCVFGDSLLETVSEDFTCLPLFLANGAESNTAIIGTWFQKTFDCYFSPLAINAFNLSWMAAMWTACKMDHYVATTEFLWSVPCSPQSLDISFAIHPEDAKALWDSVHKTPGEVTQEEVDLFMDCLYSHFHRHFKIHLSATRLVRVSTSVASAHTDGKIKILCHKYLIGVLAYLTELAIFQIE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Centromere protein M
Molecular weight formula_weight	19761.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVVNLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRATMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	Centromere protein N
Molecular weight formula_weight	39609.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQTFETHNSTTPLQERSLGLDINMDSRIIHENIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLNGSILAEREEPLRCLIKFSSPHLLEALKSLAPAGIADAPLSPLLTCIPNKRMNYFKIRDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	Centromere protein O
Molecular weight formula_weight	33830.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MEQANPLRPDGESKGGVLAHLERLETQVSRSRKQSEELQSVQAQEGALGTKIHKLRRLRDELRAVVRHRRASVKACIANVEPNQTVEINEQEALEEKLENVKAILQAYHFTGLSGKLTSRGVCVCISTAFEGNLLDSYFVDLVIQKPLRIHHHSVPVFIPLEEIAAKYLQTNIQHFLFSLCEYLNAYSGRKYQADRLQSDFAALLTGPLQRNPLCNLLSFTYKLDPGGQSFPFCARLLYKDLTATLPTDVTVTCQGVEVLSTSWEEQRASHETLFCTKPLHQVFASFTRKGEKLDMSLVS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Centromere protein P
Molecular weight formula_weight	33210.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEFQILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYRKRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Centromere protein U
Molecular weight formula_weight	47609.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGENEKDEETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESVTSKKTGPLSAQPSVEKENLAIESQSKTQKKGKISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	Centromere protein Q
Molecular weight formula_weight	30648.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSGKANASKKNAQQLKRNPKRKKDNEEVVLSENKVRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHLQTMMESVIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEIDKMVETTELMTGNIQSLKNKIQILASEVEEEEERVKQMHQINSSGVLSLPELSQKTLKAPTLQKEILALIPNQNALLKDLDILHNSSQMKSMSTFIEEAYKKLDAS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Centromere protein R
Molecular weight formula_weight	20228.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 polymer

Description description	Centromere protein T
Molecular weight formula_weight	60502.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MADHNPDSDSTPRTLLRRVLDTADPRTPRRPRSARAGARRALLETASPRKLSGQTRTIARGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGVDQGLSLSQEPQGNADASSLTRSLNLTFATPLQPQSVQRPGLARRPPARRAVDVGAFLRDLRDTSLAPPNIVLEDTQPFSQPMVGSPNVYHSLPCTPHTGAEDAEQAAGRKTQSSGPGLQKNSPGKPAQFLAGEAEEVNAFALGFLSTSSGVSGEDEVEPLHDGVEEAEKKMEEEGVSVSEMEATGAQGPSRVEEAEGHTEVTEAEGSQGTAEADGPGASSGDEDASGRAASPESASSTPESLQARRHHQFLEPAPAPGAAVLSSEPAEPLLVRHPPRPRTTGPRPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCLDKYFQHLCDDLEVFAAHAGRKTVKPEDLELLMRRQGLVTDQVSLHVLVERHLPLEYRQLLIPCAYSGNSVFPAQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 14 Entity 14 polymer

Description description	Centromere protein W
Molecular weight formula_weight	10087.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 15 Entity 15 polymer

Description description	Unknown protein
Molecular weight formula_weight	1294.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

XXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

▶

Resolution resolution	4.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	25206

Structure of the human inner kinetochore CCAN complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Centromere protein C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein M

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein N

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein O

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Centromere protein U

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer