7s4h

CryoEM structure of Methylococcus capsulatus (Bath) pMMO in a native lipid nanodisc at 2.14 Angstrom resolution

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Particulate methane monooxygenase alpha subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Ammonia monooxygenase/methane monooxygenase, subunit C family protein × 3 （Q603F1） Particulate methane monooxygenase beta subunit × 3 （Q607G3） COPPER (II) ION × 9 DECANE × 18 DIUNDECYL PHOSPHATIDYL CHOLINE × 18 1,2-dihexanoyl-sn-glycero-3-phosphocholine × 6 1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 12 water × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PMOB_METCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–414； UniProt 1–414 Author chain E； PDBConstruct 1–414； UniProt 1–414 Author chain I； PDBConstruct 1–414； UniProt 1–414

Ammonia monooxygenase/methane monooxygenase, subunit C family protein

OrganismNot specified

UniProt Q603F1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Particulate methane monooxygenase alpha subunit × 3 （G1UBD1） Particulate methane monooxygenase beta subunit × 3 （Q607G3） COPPER (II) ION × 9 DECANE × 18 DIUNDECYL PHOSPHATIDYL CHOLINE × 18 1,2-dihexanoyl-sn-glycero-3-phosphocholine × 6 1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 12 water × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q603F1_METCA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–260； UniProt 1–260 Author chain G； PDBConstruct 1–260； UniProt 1–260 Author chain K； PDBConstruct 1–260； UniProt 1–260

Particulate methane monooxygenase beta subunit

OrganismNot specified

UniProt Q607G3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Particulate methane monooxygenase alpha subunit × 3 （G1UBD1） Ammonia monooxygenase/methane monooxygenase, subunit C family protein × 3 （Q603F1） COPPER (II) ION × 9 DECANE × 18 DIUNDECYL PHOSPHATIDYL CHOLINE × 18 1,2-dihexanoyl-sn-glycero-3-phosphocholine × 6 1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 12 water × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PMOA_METCA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–247； UniProt 1–247 Author chain F； PDBConstruct 1–247； UniProt 1–247 Author chain J； PDBConstruct 1–247； UniProt 1–247

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7s4h
Deposition date deposition_date	2021-09-08
Structure title title	CryoEM structure of Methylococcus capsulatus (Bath) pMMO in a native lipid nanodisc at 2.14 Angstrom resolution
Keywords keywords	Complex, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7s4h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7s4h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7s4h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.70 Å
Rg (electron density)	39.35 Å
Total Rg	39.87 Å
Atom count	24939
Residues	2577
Excluded volume	412130 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7s4h__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Particulate methane monooxygenase alpha subunit
Molecular weight formula_weight	46129.7 kDa
EC 编号 ec_number	1.14.18.3
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E,I
Atom count atom_count	25349

MKTIKDRIAKWSAIGLLSAVAATAFYAPSASAHGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM

Entity 2 Entity 2 polymer

Description description	Ammonia monooxygenase/methane monooxygenase, subunit C family protein
Molecular weight formula_weight	29839.3 kDa
EC 编号 ec_number	1.14.13.25
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G,K

MAATTIGGAAAAEAPLLDKKWLTFALAIYTVFYLWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGYLWKTRDRNLAALTPREELRRNFTHLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGFAAFIYAKTRLPFFAKGISLPYLVLVVGPFMILPNVGLNEWGHTFWFMEELFVAPLHYGFVIFGWLALAVMGTLTQTFYSFAQGGLGQSLCEAVDEGLIAK

Entity 3 Entity 3 polymer

Description description	Particulate methane monooxygenase beta subunit
Molecular weight formula_weight	28445.1 kDa
EC 编号 ec_number	1.14.18.3
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F,J

MSAAQSAVRSHAEAVQVSRTIDWMALFVVFFVIVGSYHIHAMLTMGDWDFWSDWKDRRLWVTVTPIVLVTFPAAVQSYLWERYRLPWGATVCVLGLLLGEWINRYFNFWGWTYFPINFVFPASLVPGAIILDTVLMLSGSYLFTAIVGAMGWGLIFYPGNWPIIAPLHVPVEYNGMLMSIADIQGYNYVRTGTPEYIRMVEKGTLRTFGKDVAPVSAFFSAFMSILIYFMWHFIGRWFSNERFLQST

Entity 4 Entity 4 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 5 Entity 5 non-polymer

Description description	DECANE
Molecular weight formula_weight	142.3 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 6 Entity 6 non-polymer

Description description	DIUNDECYL PHOSPHATIDYL CHOLINE
Molecular weight formula_weight	622.8 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 7 Entity 7 non-polymer

Description description	1,2-dihexanoyl-sn-glycero-3-phosphocholine
Molecular weight formula_weight	454.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 8 Entity 8 non-polymer

Description description	1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	566.7 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 9 Entity 9 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	410

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.14 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	1381649

CryoEM structure of Methylococcus capsulatus (Bath) pMMO in a native lipid nanodisc at 2.14 Angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Particulate methane monooxygenase alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Ammonia monooxygenase/methane monooxygenase, subunit C family protein

State in the Current Structure

Other States of the Same Protein in the Database

Particulate methane monooxygenase beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s4h__assembly_1__model_1

7s4h__assembly_1__model_1 | I(q)

7s4h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 water

7. Citations (1)

CryoEM structure of Methylococcus capsulatus (Bath) pMMO in a native lipid nanodisc at 2.14 Angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Particulate methane monooxygenase alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ammonia monooxygenase/methane monooxygenase, subunit C family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Particulate methane monooxygenase beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s4h__assembly_1__model_1

7s4h__assembly_1__model_1 | I(q)

7s4h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 water

7. Citations (1)