SAXSdb — 7v8l

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lipoprotein-releasing system transmembrane protein LolE

Escherichia coli K-12

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain E； UniProt 1–414	Not recorded	Outer membrane lipoprotein RcsF × 1 （P69411） Lipoprotein-releasing system transmembrane protein LolC × 1 （P0ADC3） Lipoprotein-releasing system ATP-binding protein LolD × 2 （P75957） PCJ (2R)-3-{[(2S)-3-HYDROXY-2-(PALMITOYLAMINO)PROPYL]THIO}PROPANE-1,2-DIYL DIHEXADECANOATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 3.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7V8L	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7ARH LolCDE in complex with lipoprotein Deposited 2020-10-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7ARI LolCDE apo structure Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7ARJ LolCDE in complex with lipoprotein and AMPPNP complex undimerized form Deposited 2020-10-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7ARK LolCDE in complex with AMP-PNP in the closed NBD state Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7ARL LolCDE in complex with lipoprotein and ADP Deposited 2020-10-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7ARM LolCDE in complex with lipoprotein and LolA Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–414（414 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7MDX LolCDE nucleotide-free Deposited 2021-04-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 6–408（403 aa）	Not recorded	F15 PENTADECANOIC ACID × 1 ZM5 (2R)-2-(tridecanoyloxy)propyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7V8I LolCD(E171Q)E with bound AMPPNP in nanodiscs Deposited 2021-08-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
7V8M LolCDE-apo in nanodiscs Deposited 2021-08-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.20 Å
9GRC Cryo-EM structure of lipoprotein-bound LolCDE in nanodiscs Deposited 2024-09-11	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9GVK Cryo-EM structure of endogenous ATP-bound LolCDE with LolD-E171Q mutations in nanodiscs Deposited 2024-09-25	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9RLC LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9RLD LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9RLE LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
9RLF LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
9RLG LolCDE complex with LolB lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9RLH LolCDE complex with del 9-15 LolB lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
9RLI LolCDEdelta(235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–234（234 aa） Chain E 253–414（162 aa）	Mutation：delta 235-252 Mutation：delta 235-252	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.63 Å
9RLJ LolCDE with bound ATPgammaS Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9RLK LolCDE(delta 235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–234（234 aa） Chain E 253–414（162 aa）	Mutation：delta 235-252 (inclusive) with GS linker Mutation：delta 235-252 (inclusive) with GS linker	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
9XRO LolCDE in complex with SMT-738_3 Deposited 2025-11-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1–414（414 aa）	Not recorded	A1ER4 2-azanyl-1-[6-[2-azanyl-5-(3-methylpyridin-4-yl)-1H-imidazol-4-yl]-2,3-dihydro-1,4-benzoxazin-4-yl]-2-methyl-propan-1-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å

21 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LOLE_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–414； UniProt 1–414

Outer membrane lipoprotein RcsF

Escherichia coli K-12

UniProt P69411

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain A； UniProt 17–134	Not recorded	Lipoprotein-releasing system transmembrane protein LolE × 1 （P75958） Lipoprotein-releasing system transmembrane protein LolC × 1 （P0ADC3） Lipoprotein-releasing system ATP-binding protein LolD × 2 （P75957） PCJ (2R)-3-{[(2S)-3-HYDROXY-2-(PALMITOYLAMINO)PROPYL]THIO}PROPANE-1,2-DIYL DIHEXADECANOATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 3.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7V8L	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2L8Y Solution structure of the E. coli outer membrane protein RcsF (periplasmatic domain) Deposited 2011-01-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 31–134（104 aa） Fragment：periplasmatic domain, Residues 31-134	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 0.100；Pressure ambient NMR sample composition 0.6mM [U-98% 13C; U-98% 15N] RcsF(31-134); 50mM sodium phosphate; 100mM sodium chloride; 4.6mM protease inhibitors cocktail; 0.3mM DSS; 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RCSF_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–118； UniProt 17–134

Lipoprotein-releasing system transmembrane protein LolC

Escherichia coli K-12

UniProt P0ADC3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain C； UniProt 1–399	Not recorded	Lipoprotein-releasing system transmembrane protein LolE × 1 （P75958） Outer membrane lipoprotein RcsF × 1 （P69411） Lipoprotein-releasing system ATP-binding protein LolD × 2 （P75957） PCJ (2R)-3-{[(2S)-3-HYDROXY-2-(PALMITOYLAMINO)PROPYL]THIO}PROPANE-1,2-DIYL DIHEXADECANOATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 3.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7V8L	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5NAA Lipoprotein-releasing system transmembrane protein LolC Deposited 2017-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 48–266（219 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 1.88 Å R-free 0.225
5NAA Lipoprotein-releasing system transmembrane protein LolC Deposited 2017-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 48–266（219 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 1.88 Å R-free 0.225
6F3Z Complex of E. coli LolA and periplasmic domain of LolC Deposited 2017-11-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 48–266（219 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；45% w/v Poly(acrylic acid sodium salt) 2100, 100 mM HEPES pH 6.5	Resolution 2.00 Å R-free 0.249
6F3Z Complex of E. coli LolA and periplasmic domain of LolC Deposited 2017-11-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 48–266（219 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；45% w/v Poly(acrylic acid sodium salt) 2100, 100 mM HEPES pH 6.5	Resolution 2.00 Å R-free 0.249
6F49 Periplasmic domain of LolC lacking the Hook. Deposited 2017-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 48–179（132 aa） Chain A 180–266（87 aa）	Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M ammonium sulfate, 0.15 M sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 2.02 Å R-free 0.233
6F49 Periplasmic domain of LolC lacking the Hook. Deposited 2017-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 48–179（132 aa） Chain B 180–266（87 aa）	Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A	GOL GLYCEROL × 3 PG5 1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M ammonium sulfate, 0.15 M sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 2.02 Å R-free 0.233
6F49 Periplasmic domain of LolC lacking the Hook. Deposited 2017-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 48–179（132 aa） Chain C 180–266（87 aa）	Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A	GOL GLYCEROL × 3 PG5 1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M ammonium sulfate, 0.15 M sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 2.02 Å R-free 0.233
6F49 Periplasmic domain of LolC lacking the Hook. Deposited 2017-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 48–179（132 aa） Chain D 180–266（87 aa）	Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M ammonium sulfate, 0.15 M sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 2.02 Å R-free 0.233
7MDX LolCDE nucleotide-free Deposited 2021-04-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 2–394（393 aa）	Not recorded	F15 PENTADECANOIC ACID × 1 ZM5 (2R)-2-(tridecanoyloxy)propyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7V8I LolCD(E171Q)E with bound AMPPNP in nanodiscs Deposited 2021-08-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–399（399 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
7V8M LolCDE-apo in nanodiscs Deposited 2021-08-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–399（399 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.20 Å
9GRC Cryo-EM structure of lipoprotein-bound LolCDE in nanodiscs Deposited 2024-09-11	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9GVK Cryo-EM structure of endogenous ATP-bound LolCDE with LolD-E171Q mutations in nanodiscs Deposited 2024-09-25	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–399（399 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9RLC LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9RLD LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9RLE LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
9RLF LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
9RLG LolCDE complex with LolB lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9RLH LolCDE complex with del 9-15 LolB lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
9RLI LolCDEdelta(235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.63 Å
9RLJ LolCDE with bound ATPgammaS Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–399（399 aa）	Not recorded	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9RLK LolCDE(delta 235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
9XRO LolCDE in complex with SMT-738_3 Deposited 2025-11-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–399（399 aa）	Not recorded	A1ER4 2-azanyl-1-[6-[2-azanyl-5-(3-methylpyridin-4-yl)-1H-imidazol-4-yl]-2,3-dihydro-1,4-benzoxazin-4-yl]-2-methyl-propan-1-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å

18 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LOLC_ECOLI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–399； UniProt 1–399

Lipoprotein-releasing system ATP-binding protein LolD

Escherichia coli K-12

UniProt P75957

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain D； UniProt 1–233 Chain F； UniProt 1–233	Not recorded	Lipoprotein-releasing system transmembrane protein LolE × 1 （P75958） Outer membrane lipoprotein RcsF × 1 （P69411） Lipoprotein-releasing system transmembrane protein LolC × 1 （P0ADC3） PCJ (2R)-3-{[(2S)-3-HYDROXY-2-(PALMITOYLAMINO)PROPYL]THIO}PROPANE-1,2-DIYL DIHEXADECANOATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 3.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7V8L	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7ARH LolCDE in complex with lipoprotein Deposited 2020-10-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7ARI LolCDE apo structure Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7ARJ LolCDE in complex with lipoprotein and AMPPNP complex undimerized form Deposited 2020-10-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7ARK LolCDE in complex with AMP-PNP in the closed NBD state Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7ARL LolCDE in complex with lipoprotein and ADP Deposited 2020-10-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7ARM LolCDE in complex with lipoprotein and LolA Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7MDX LolCDE nucleotide-free Deposited 2021-04-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 4–221（218 aa） Chain D 4–221（218 aa）	Not recorded	F15 PENTADECANOIC ACID × 1 ZM5 (2R)-2-(tridecanoyloxy)propyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7V8I LolCD(E171Q)E with bound AMPPNP in nanodiscs Deposited 2021-08-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
7V8M LolCDE-apo in nanodiscs Deposited 2021-08-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.20 Å
9GRC Cryo-EM structure of lipoprotein-bound LolCDE in nanodiscs Deposited 2024-09-11	Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9GVK Cryo-EM structure of endogenous ATP-bound LolCDE with LolD-E171Q mutations in nanodiscs Deposited 2024-09-25	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9RLC LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9RLD LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9RLE LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
9RLF LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
9RLG LolCDE complex with LolB lipoprotein Deposited 2025-06-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9RLH LolCDE complex with del 9-15 LolB lipoprotein Deposited 2025-06-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
9RLI LolCDEdelta(235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.63 Å
9RLJ LolCDE with bound ATPgammaS Deposited 2025-06-16	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9RLK LolCDE(delta 235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
9XRO LolCDE in complex with SMT-738_3 Deposited 2025-11-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–233（233 aa）	Not recorded	A1ER4 2-azanyl-1-[6-[2-azanyl-5-(3-methylpyridin-4-yl)-1H-imidazol-4-yl]-2,3-dihydro-1,4-benzoxazin-4-yl]-2-methyl-propan-1-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å

21 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LOLD_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–233； UniProt 1–233 Author chain F； PDBConstruct 1–233； UniProt 1–233

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7v8l
Deposition date deposition_date	2021-08-23
Structure title title	LolCDE with bound RcsF in nanodiscs
Keywords keywords	membrane protein, ABC transporter, lipoprotein; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	45.36 Å
Radius of gyration Rg (electron density) rg_electron	44.68 Å
Forward intensity I(0) i0	257302000.00
Molecular weight molecular_weight	135240.0 kDa
Excluded volume excluded_volume	171060 Å³
Envelope volume envelope_volume	249890 Å³
Hydration-shell volume shell_volume	48642 Å³
Envelope diameter envelope_diameter	146.8 Å
Shell Rg shell_rg	46.42 Å
Envelope Rg envelope_rg	44.44 Å
Shape Rg shape_rg	44.72 Å
Total Rg total_rg	44.61 Å
Total atoms total_atoms	9610
Residues n_residues	1277
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	135.2 Å
Rg (real space) rg_real	45.70 Å
Rg uncertainty (real space) rg_real_error	1.26 Å
I(0) (real space) i0_real	2.5730e+08
I(0) uncertainty (real space) i0_real_error	4.6510e+06
Rg (reciprocal space) rg_reciprocal	45.36 Å
I(0) (reciprocal space) i0_reciprocal	257200000.0000
Solution quality estimate total_estimate	0.7999
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	38.6 Å
Skewness Skewness skewness	0.382
Kurtosis Kurtosis kurtosis	-0.823
Angular range angular_range	— – 0.1750 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	29030000.0000
Real-space data points n_real_points	36
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.861; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.815; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Lipoprotein-releasing system transmembrane protein LolE
Molecular weight formula_weight	45386.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E
Atom count atom_count	9610

MAMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRILAVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLMQPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRDAGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSGDIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFLSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ

来源 Source

来源生物 organism	Escherichia coli K-12
NCBI Class编号 ncbi_taxonomy_id	83333
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Outer membrane lipoprotein RcsF
Molecular weight formula_weight	12506.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

SMLSRSPVEPVQSTAPQPKAEPAKPKAPRATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNITAK

来源 Source

来源生物 organism	Escherichia coli K-12
NCBI Class编号 ncbi_taxonomy_id	83333
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Lipoprotein-releasing system transmembrane protein LolC
Molecular weight formula_weight	43295.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNILGLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPAQKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPSQRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKLPEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAILQTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAIEPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE

来源 Source

来源生物 organism	Escherichia coli K-12
NCBI Class编号 ncbi_taxonomy_id	83333
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Lipoprotein-releasing system ATP-binding protein LolD
Molecular weight formula_weight	25471.3 kDa
EC 编号 ec_number	7.6.2.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,F

MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPAEINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAE

来源 Source

来源生物 organism	Escherichia coli K-12
NCBI Class编号 ncbi_taxonomy_id	83333
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 non-polymer

Description description	(2R)-3-{[(2S)-3-HYDROXY-2-(PALMITOYLAMINO)PROPYL]THIO}PROPANE-1,2-DIYL DIHEXADECANOATE
Molecular weight formula_weight	896.5 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (1)

▶

Resolution resolution	3.50 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	225933

fit	/app/data/saxs_computation/v8/7v8l/7v8l.fit
pddf	/app/data/pr_computation/v8/7v8l/7v8l.pr.out
profile	/app/data/saxs_computation/v8/7v8l/7v8l.dat

LolCDE with bound RcsF in nanodiscs

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lipoprotein-releasing system transmembrane protein LolE

State in the Current Structure

Other States of the Same Protein in the Database

Outer membrane lipoprotein RcsF

State in the Current Structure

Other States of the Same Protein in the Database

Lipoprotein-releasing system transmembrane protein LolC

State in the Current Structure

Other States of the Same Protein in the Database

Lipoprotein-releasing system ATP-binding protein LolD

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)