SAXSdb — 9rlj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lipoprotein-releasing system transmembrane protein LolC

Escherichia coli K-12

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain C； UniProt 1–399	Not recorded	Lipoprotein-releasing system transmembrane protein LolE × 1 （P75958） Lipoprotein-releasing system ATP-binding protein LolD × 2 （P75957） AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9RLJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5NAA Lipoprotein-releasing system transmembrane protein LolC Deposited 2017-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 48–266（219 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 1.88 Å R-free 0.225
5NAA Lipoprotein-releasing system transmembrane protein LolC Deposited 2017-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 48–266（219 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M Ammonium sulfate, 0.1 M Sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 1.88 Å R-free 0.225
6F3Z Complex of E. coli LolA and periplasmic domain of LolC Deposited 2017-11-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 48–266（219 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；45% w/v Poly(acrylic acid sodium salt) 2100, 100 mM HEPES pH 6.5	Resolution 2.00 Å R-free 0.249
6F3Z Complex of E. coli LolA and periplasmic domain of LolC Deposited 2017-11-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 48–266（219 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；45% w/v Poly(acrylic acid sodium salt) 2100, 100 mM HEPES pH 6.5	Resolution 2.00 Å R-free 0.249
6F49 Periplasmic domain of LolC lacking the Hook. Deposited 2017-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 48–179（132 aa） Chain A 180–266（87 aa）	Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M ammonium sulfate, 0.15 M sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 2.02 Å R-free 0.233
6F49 Periplasmic domain of LolC lacking the Hook. Deposited 2017-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 48–179（132 aa） Chain B 180–266（87 aa）	Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A	GOL GLYCEROL × 3 PG5 1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M ammonium sulfate, 0.15 M sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 2.02 Å R-free 0.233
6F49 Periplasmic domain of LolC lacking the Hook. Deposited 2017-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 48–179（132 aa） Chain C 180–266（87 aa）	Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A	GOL GLYCEROL × 3 PG5 1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M ammonium sulfate, 0.15 M sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 2.02 Å R-free 0.233
6F49 Periplasmic domain of LolC lacking the Hook. Deposited 2017-11-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 48–179（132 aa） Chain D 180–266（87 aa）	Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A Mutation：delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A,delta[169-179], P167G, S168A	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；288.15 K；0.2 M ammonium sulfate, 0.15 M sodium acetate pH 4.6, 30% w/v PEG 2000 MME	Resolution 2.02 Å R-free 0.233
7MDX LolCDE nucleotide-free Deposited 2021-04-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 2–394（393 aa）	Not recorded	F15 PENTADECANOIC ACID × 1 ZM5 (2R)-2-(tridecanoyloxy)propyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7V8I LolCD(E171Q)E with bound AMPPNP in nanodiscs Deposited 2021-08-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–399（399 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
7V8L LolCDE with bound RcsF in nanodiscs Deposited 2021-08-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PCJ (2R)-3-{[(2S)-3-HYDROXY-2-(PALMITOYLAMINO)PROPYL]THIO}PROPANE-1,2-DIYL DIHEXADECANOATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.50 Å
7V8M LolCDE-apo in nanodiscs Deposited 2021-08-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–399（399 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.20 Å
9GRC Cryo-EM structure of lipoprotein-bound LolCDE in nanodiscs Deposited 2024-09-11	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9GVK Cryo-EM structure of endogenous ATP-bound LolCDE with LolD-E171Q mutations in nanodiscs Deposited 2024-09-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–399（399 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9RLC LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9RLD LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9RLE LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
9RLF LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
9RLG LolCDE complex with LolB lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9RLH LolCDE complex with del 9-15 LolB lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
9RLI LolCDEdelta(235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.63 Å
9RLK LolCDE(delta 235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–399（399 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
9XRO LolCDE in complex with SMT-738_3 Deposited 2025-11-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–399（399 aa）	Not recorded	A1ER4 2-azanyl-1-[6-[2-azanyl-5-(3-methylpyridin-4-yl)-1H-imidazol-4-yl]-2,3-dihydro-1,4-benzoxazin-4-yl]-2-methyl-propan-1-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å

18 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LOLC_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–399； UniProt 1–399

Lipoprotein-releasing system transmembrane protein LolE

Escherichia coli K-12

UniProt P75958

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain E； UniProt 1–414	Not recorded	Lipoprotein-releasing system transmembrane protein LolC × 1 （P0ADC3） Lipoprotein-releasing system ATP-binding protein LolD × 2 （P75957） AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9RLJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7ARH LolCDE in complex with lipoprotein Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7ARI LolCDE apo structure Deposited 2020-10-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7ARJ LolCDE in complex with lipoprotein and AMPPNP complex undimerized form Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7ARK LolCDE in complex with AMP-PNP in the closed NBD state Deposited 2020-10-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7ARL LolCDE in complex with lipoprotein and ADP Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7ARM LolCDE in complex with lipoprotein and LolA Deposited 2020-10-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–414（414 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7MDX LolCDE nucleotide-free Deposited 2021-04-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 6–408（403 aa）	Not recorded	F15 PENTADECANOIC ACID × 1 ZM5 (2R)-2-(tridecanoyloxy)propyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7V8I LolCD(E171Q)E with bound AMPPNP in nanodiscs Deposited 2021-08-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
7V8L LolCDE with bound RcsF in nanodiscs Deposited 2021-08-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PCJ (2R)-3-{[(2S)-3-HYDROXY-2-(PALMITOYLAMINO)PROPYL]THIO}PROPANE-1,2-DIYL DIHEXADECANOATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.50 Å
7V8M LolCDE-apo in nanodiscs Deposited 2021-08-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.20 Å
9GRC Cryo-EM structure of lipoprotein-bound LolCDE in nanodiscs Deposited 2024-09-11	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9GVK Cryo-EM structure of endogenous ATP-bound LolCDE with LolD-E171Q mutations in nanodiscs Deposited 2024-09-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–414（414 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9RLC LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9RLD LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9RLE LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
9RLF LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
9RLG LolCDE complex with LolB lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9RLH LolCDE complex with del 9-15 LolB lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–414（414 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
9RLI LolCDEdelta(235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–234（234 aa） Chain E 253–414（162 aa）	Mutation：delta 235-252 Mutation：delta 235-252	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.63 Å
9RLK LolCDE(delta 235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–234（234 aa） Chain E 253–414（162 aa）	Mutation：delta 235-252 (inclusive) with GS linker Mutation：delta 235-252 (inclusive) with GS linker	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
9XRO LolCDE in complex with SMT-738_3 Deposited 2025-11-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1–414（414 aa）	Not recorded	A1ER4 2-azanyl-1-[6-[2-azanyl-5-(3-methylpyridin-4-yl)-1H-imidazol-4-yl]-2,3-dihydro-1,4-benzoxazin-4-yl]-2-methyl-propan-1-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å

21 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LOLE_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–414； UniProt 1–414

Lipoprotein-releasing system ATP-binding protein LolD

Escherichia coli K-12

UniProt P75957

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain D； UniProt 1–233 Chain F； UniProt 1–233	Mutation：C-terminal His tag (GSHHHHHH)	Lipoprotein-releasing system transmembrane protein LolC × 1 （P0ADC3） Lipoprotein-releasing system transmembrane protein LolE × 1 （P75958） AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9RLJ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7ARH LolCDE in complex with lipoprotein Deposited 2020-10-25	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7ARI LolCDE apo structure Deposited 2020-10-25	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7ARJ LolCDE in complex with lipoprotein and AMPPNP complex undimerized form Deposited 2020-10-25	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7ARK LolCDE in complex with AMP-PNP in the closed NBD state Deposited 2020-10-25	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7ARL LolCDE in complex with lipoprotein and ADP Deposited 2020-10-25	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7ARM LolCDE in complex with lipoprotein and LolA Deposited 2020-10-25	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8；20 mM Tris-HCl, pH 7.8, 150 mM NaCl and 0.05% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7MDX LolCDE nucleotide-free Deposited 2021-04-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 4–221（218 aa） Chain D 4–221（218 aa）	Not recorded	F15 PENTADECANOIC ACID × 1 ZM5 (2R)-2-(tridecanoyloxy)propyl hexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7V8I LolCD(E171Q)E with bound AMPPNP in nanodiscs Deposited 2021-08-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.60 Å
7V8L LolCDE with bound RcsF in nanodiscs Deposited 2021-08-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	PCJ (2R)-3-{[(2S)-3-HYDROXY-2-(PALMITOYLAMINO)PROPYL]THIO}PROPANE-1,2-DIYL DIHEXADECANOATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.50 Å
7V8M LolCDE-apo in nanodiscs Deposited 2021-08-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.20 Å
9GRC Cryo-EM structure of lipoprotein-bound LolCDE in nanodiscs Deposited 2024-09-11	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9GVK Cryo-EM structure of endogenous ATP-bound LolCDE with LolD-E171Q mutations in nanodiscs Deposited 2024-09-25	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9RLC LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Not recorded	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9RLD LolCDE complex with Lpp lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9RLE LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
9RLF LolCDE complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
9RLG LolCDE complex with LolB lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9RLH LolCDE complex with del 9-15 LolB lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
9RLI LolCDEdelta(235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.63 Å
9RLK LolCDE(delta 235-252) complex with Pal lipoprotein Deposited 2025-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 1–233（233 aa） Chain F 1–233（233 aa）	Mutation：C-terminal His tag (GSHHHHHH) Mutation：C-terminal His tag (GSHHHHHH)	PLM PALMITIC ACID × 1 Z41 (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
9XRO LolCDE in complex with SMT-738_3 Deposited 2025-11-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–233（233 aa）	Not recorded	A1ER4 2-azanyl-1-[6-[2-azanyl-5-(3-methylpyridin-4-yl)-1H-imidazol-4-yl]-2,3-dihydro-1,4-benzoxazin-4-yl]-2-methyl-propan-1-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.88 Å

21 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LOLD_ECOLI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–233； UniProt 1–233 Author chain F； PDBConstruct 1–233； UniProt 1–233

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rlj
Deposition date deposition_date	2025-06-16
Structure title title	LolCDE with bound ATPgammaS
Keywords keywords	Gram-negative, envelope biogenesis, outer membrane protein, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	44.53 Å
Radius of gyration Rg (electron density) rg_electron	44.23 Å
Forward intensity I(0) i0	279660000.00
Molecular weight molecular_weight	139370.0 kDa
Excluded volume excluded_volume	175640 Å³
Envelope volume envelope_volume	240320 Å³
Hydration-shell volume shell_volume	47709 Å³
Envelope diameter envelope_diameter	142.6 Å
Shell Rg shell_rg	45.80 Å
Envelope Rg envelope_rg	43.76 Å
Shape Rg shape_rg	44.24 Å
Total Rg total_rg	44.29 Å
Total atoms total_atoms	9775
Residues n_residues	1268
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	133.2 Å
Rg (real space) rg_real	44.97 Å
Rg uncertainty (real space) rg_real_error	1.24 Å
I(0) (real space) i0_real	2.7970e+08
I(0) uncertainty (real space) i0_real_error	4.8740e+06
Rg (reciprocal space) rg_reciprocal	44.53 Å
I(0) (reciprocal space) i0_reciprocal	279500000.0000
Solution quality estimate total_estimate	0.7327
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	34.2 Å
Skewness Skewness skewness	0.411
Kurtosis Kurtosis kurtosis	-0.913
Angular range angular_range	— – 0.1750 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	74100000.0000
Real-space data points n_real_points	36
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.625; Stabil: 0.998; Sysdev: 1.000; Positv: 1.000; Valcen: 0.653; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Lipoprotein-releasing system transmembrane protein LolC
Molecular weight formula_weight	43295.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	9775

MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNILGLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPAQKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPSQRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKLPEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAILQTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAIEPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE

来源 Source

来源生物 organism	Escherichia coli K-12
NCBI Class编号 ncbi_taxonomy_id	83333
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Lipoprotein-releasing system transmembrane protein LolE
Molecular weight formula_weight	45386.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRILAVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLMQPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRDAGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSGDIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFLSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ

来源 Source

来源生物 organism	Escherichia coli K-12
NCBI Class编号 ncbi_taxonomy_id	83333
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Lipoprotein-releasing system ATP-binding protein LolD
Molecular weight formula_weight	26306.2 kDa
EC 编号 ec_number	7.6.2.-
Mutation mutation	C-terminal His tag (GSHHHHHH)
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,F

MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPAEINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAEGSHHHHH

来源 Source

来源生物 organism	Escherichia coli K-12
NCBI Class编号 ncbi_taxonomy_id	83333
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.90 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	229634

fit	/app/data/saxs_computation/rl/9rlj/9rlj.fit
pddf	/app/data/pr_computation/rl/9rlj/9rlj.pr.out
profile	/app/data/saxs_computation/rl/9rlj/9rlj.dat

LolCDE with bound ATPgammaS

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lipoprotein-releasing system transmembrane protein LolC

State in the Current Structure

Other States of the Same Protein in the Database

Lipoprotein-releasing system transmembrane protein LolE

State in the Current Structure

Other States of the Same Protein in the Database

Lipoprotein-releasing system ATP-binding protein LolD

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)