SAXSdb — 7vik

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

Escherichia phage lambda

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Capsid decoration protein × 7 （P03712）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSD_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–341； UniProt 1–341 Author chain B； PDBConstruct 1–341； UniProt 1–341 Author chain C； PDBConstruct 1–341； UniProt 1–341 Author chain D； PDBConstruct 1–341； UniProt 1–341 Author chain E； PDBConstruct 1–341； UniProt 1–341 Author chain F； PDBConstruct 1–341； UniProt 1–341 Author chain G； PDBConstruct 1–341； UniProt 1–341

Capsid decoration protein

Escherichia phage lambda

UniProt P03712

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Major capsid protein × 7 （P03713）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DECO_LAMBD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–110； UniProt 1–110 Author chain I； PDBConstruct 1–110； UniProt 1–110 Author chain J； PDBConstruct 1–110； UniProt 1–110 Author chain K； PDBConstruct 1–110； UniProt 1–110 Author chain L； PDBConstruct 1–110； UniProt 1–110 Author chain M； PDBConstruct 1–110； UniProt 1–110 Author chain N； PDBConstruct 1–110； UniProt 1–110

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7vik
Deposition date deposition_date	2021-09-27
Structure title title	Asymmetric unit of cryoEM structure of bacteriophage lambda capsid at 3.76 Angstrom
Keywords keywords	;bacteriophage lambda; capsid; procapsid; capsid maturation; virus structure; cryo-EM; auxiliary protein; conformational expansion; cementing protein; DNA packaging, VIRUS ;; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7vik__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7vik__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7vik__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.96 Å
Rg (electron density)	65.08 Å
Total Rg	65.04 Å
Atom count	24325
Residues	3136
Excluded volume	431300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7vik__assembly_1__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Major capsid protein
Molecular weight formula_weight	38229.2 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G
Atom count atom_count	24346

MSMYTTAQLLAANEQKFKFDPLFLRLFFRESYPFTTEKVYLSQIPGLVNMALYVSPIVSGEVIRSRGGSTSEFTPGYVKPKHEVNPQMTLRRLPDEDPQNLADPAYRRRRIIMQNMRDEELAIAQVEEMQAVSAVLKGKYTMTGEAFDPVEVDMGRSEENNITQSGGTEWSKRDKSTYDPTDDIEAYALNASGVVNIIVFDPKGWALFRSFKAVKEKLDTRRGSNSELETAVKDLGKAVSYKGMYGDVAIVVYSGQYVENGVKKNFLPDNTMVLGNTQARGLRTYGCIQDADAQREGINASARYPKNWVTTGDPAREFTMIQSAPLMLLADPDEFVSVQLA

Source Source

Source organism organism	Escherichia phage lambda
Common name common_name	Bacteriophage lambda
NCBI taxonomy ID ncbi_taxonomy_id	10710
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Capsid decoration protein
Molecular weight formula_weight	11582.9 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I,J,K,L,M,N

MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV

Source Source

Source organism organism	Escherichia phage lambda
Common name common_name	Bacteriophage lambda
NCBI taxonomy ID ncbi_taxonomy_id	10710
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 7 domains

CATH v4.4 (7 domains)

Domain ID domain_id	7vikH01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	300 — Virus Head Decoration Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Head decoration protein D

Domain ID domain_id	7vikI01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	300 — Virus Head Decoration Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Head decoration protein D

Domain ID domain_id	7vikJ01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	300 — Virus Head Decoration Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Head decoration protein D

Domain ID domain_id	7vikK01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	300 — Virus Head Decoration Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Head decoration protein D

Domain ID domain_id	7vikL01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	300 — Virus Head Decoration Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Head decoration protein D

Domain ID domain_id	7vikM01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	300 — Virus Head Decoration Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Head decoration protein D

Domain ID domain_id	7vikN01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	300 — Virus Head Decoration Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Head decoration protein D

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.76 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	835912

Asymmetric unit of cryoEM structure of bacteriophage lambda capsid at 3.76 Angstrom

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Capsid decoration protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7vik__assembly_1__model_1

7vik__assembly_1__model_1 | I(q)

7vik__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 7 domains

CATH v4.4 (7 domains)

7. Citations (1)

Asymmetric unit of cryoEM structure of bacteriophage lambda capsid at 3.76 Angstrom

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid decoration protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7vik__assembly_1__model_1

7vik__assembly_1__model_1 | I(q)

7vik__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 7 domains

CATH v4.4 (7 domains)

7. Citations (1)