SAXSdb — 8xqb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Head-tail connector protein FII

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 71	Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710） Major capsid protein × 15 （P03713） Capsid decoration protein × 20 （P03712）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FII_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain f； PDBConstruct 1–117； UniProt 1–117 Author chain f1； PDBConstruct 1–117； UniProt 1–117 Author chain f2； PDBConstruct 1–117； UniProt 1–117 Author chain f3； PDBConstruct 1–117； UniProt 1–117 Author chain f4； PDBConstruct 1–117； UniProt 1–117 Author chain f5； PDBConstruct 1–117； UniProt 1–117

Head completion protein

OrganismNot specified

UniProt P68660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 71	Head-tail connector protein FII × 6 （P03714） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710） Major capsid protein × 15 （P03713） Capsid decoration protein × 20 （P03712）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HCP_LAMBD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain W； PDBConstruct 1–68； UniProt 1–68 Author chain W1； PDBConstruct 1–68； UniProt 1–68 Author chain W2； PDBConstruct 1–68； UniProt 1–68 Author chain W3； PDBConstruct 1–68； UniProt 1–68 Author chain W4； PDBConstruct 1–68； UniProt 1–68 Author chain W5； PDBConstruct 1–68； UniProt 1–68 Author chain w； PDBConstruct 1–68； UniProt 1–68 Author chain w1； PDBConstruct 1–68； UniProt 1–68 Author chain w2； PDBConstruct 1–68； UniProt 1–68 Author chain w3； PDBConstruct 1–68； UniProt 1–68 Author chain w4； PDBConstruct 1–68； UniProt 1–68 Author chain w5； PDBConstruct 1–68； UniProt 1–68

Tail tube terminator protein

OrganismNot specified

UniProt P03732

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 71	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Portal protein B × 12 （P03710） Major capsid protein × 15 （P03713） Capsid decoration protein × 20 （P03712）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TTTP_LAMBD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain U； PDBConstruct 1–131； UniProt 1–131 Author chain U1； PDBConstruct 1–131； UniProt 1–131 Author chain U2； PDBConstruct 1–131； UniProt 1–131 Author chain U3； PDBConstruct 1–131； UniProt 1–131 Author chain U4； PDBConstruct 1–131； UniProt 1–131 Author chain U5； PDBConstruct 1–131； UniProt 1–131

Portal protein B

OrganismNot specified

UniProt P03710

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 71	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732） Major capsid protein × 15 （P03713） Capsid decoration protein × 20 （P03712）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PORTL_LAMBD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–533； UniProt 1–533 Author chain B1； PDBConstruct 1–533； UniProt 1–533 Author chain B2； PDBConstruct 1–533； UniProt 1–533 Author chain B3； PDBConstruct 1–533； UniProt 1–533 Author chain B4； PDBConstruct 1–533； UniProt 1–533 Author chain B5； PDBConstruct 1–533； UniProt 1–533 Author chain b； PDBConstruct 1–533； UniProt 1–533 Author chain b1； PDBConstruct 1–533； UniProt 1–533 Author chain b2； PDBConstruct 1–533； UniProt 1–533 Author chain b3； PDBConstruct 1–533； UniProt 1–533 Author chain b4； PDBConstruct 1–533； UniProt 1–533 Author chain b5； PDBConstruct 1–533； UniProt 1–533

Major capsid protein

OrganismNot specified

UniProt P03713

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 71	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710） Capsid decoration protein × 20 （P03712）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSD_LAMBD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A0； PDBConstruct 1–341； UniProt 1–341 Author chain A1； PDBConstruct 1–341； UniProt 1–341 Author chain A2； PDBConstruct 1–341； UniProt 1–341 Author chain A3； PDBConstruct 1–341； UniProt 1–341 Author chain A4； PDBConstruct 1–341； UniProt 1–341 Author chain C0； PDBConstruct 1–341； UniProt 1–341 Author chain C1； PDBConstruct 1–341； UniProt 1–341 Author chain C2； PDBConstruct 1–341； UniProt 1–341 Author chain C3； PDBConstruct 1–341； UniProt 1–341 Author chain C4； PDBConstruct 1–341； UniProt 1–341 Author chain G0； PDBConstruct 1–341； UniProt 1–341 Author chain G1； PDBConstruct 1–341； UniProt 1–341 Author chain G2； PDBConstruct 1–341； UniProt 1–341 Author chain G3； PDBConstruct 1–341； UniProt 1–341 Author chain G4； PDBConstruct 1–341； UniProt 1–341

Capsid decoration protein

OrganismNot specified

UniProt P03712

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 71	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710） Major capsid protein × 15 （P03713）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DECO_LAMBD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H0； PDBConstruct 1–110； UniProt 1–110 Author chain H1； PDBConstruct 1–110； UniProt 1–110 Author chain H2； PDBConstruct 1–110； UniProt 1–110 Author chain H3； PDBConstruct 1–110； UniProt 1–110 Author chain H4； PDBConstruct 1–110； UniProt 1–110 Author chain I0； PDBConstruct 1–110； UniProt 1–110 Author chain I1； PDBConstruct 1–110； UniProt 1–110 Author chain I2； PDBConstruct 1–110； UniProt 1–110 Author chain I3； PDBConstruct 1–110； UniProt 1–110 Author chain I4； PDBConstruct 1–110； UniProt 1–110 Author chain J0； PDBConstruct 1–110； UniProt 1–110 Author chain J1； PDBConstruct 1–110； UniProt 1–110 Author chain J2； PDBConstruct 1–110； UniProt 1–110 Author chain J3； PDBConstruct 1–110； UniProt 1–110 Author chain J4； PDBConstruct 1–110； UniProt 1–110 Author chain N0； PDBConstruct 1–110； UniProt 1–110 Author chain N1； PDBConstruct 1–110； UniProt 1–110 Author chain N2； PDBConstruct 1–110； UniProt 1–110 Author chain N3； PDBConstruct 1–110； UniProt 1–110 Author chain N4； PDBConstruct 1–110； UniProt 1–110

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8xqb
Deposition date deposition_date	2024-01-05
Structure title title	Mature virion portal vertex of bacteriophage lambda
Keywords keywords	caudovirales, siphoviridae, portal, capsid, connector/neck, tail, delivery device, B-DNA, phage lambda, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8xqb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8xqb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8xqb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	85.36 Å
Rg (electron density)	85.40 Å
Total Rg	85.45 Å
Atom count	118454
Residues	15222
Excluded volume	2087400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8xqb__assembly_1__model_1`	71-meric （71）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Head-tail connector protein FII
Molecular weight formula_weight	12775.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,f1,f2,f3,f4,f5
Atom count atom_count	118514

MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR

Entity 2 Entity 2 polymer

Description description	Head completion protein
Molecular weight formula_weight	7625.7 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,w,W1,w1,W2,w2,W3,w3,W4,w4,W5,w5

MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRGPAGFYV

Entity 3 Entity 3 polymer

Description description	Tail tube terminator protein
Molecular weight formula_weight	14659.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,U1,U2,U3,U4,U5

MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM

Entity 4 Entity 4 polymer

Description description	Portal protein B
Molecular weight formula_weight	59529.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b,B1,b1,B2,b2,B3,b3,B4,b4,B5,b5

MKTPTIPTLLGPDGMTSLREYAGYHGGGSGFGGQLRSWNPPSESVDAALLPNFTRGNARADDLVRNNGYAANAIQLHQDHIVGSFFRLSHRPSWRYLGIGEEEARAFSREVEAAWKEFAEDDCCCIDVERKRTFTMMIREGVAMHAFNGELFVQATWDTSSSRLFRTQFRMVSPKRISNPNNTGDSRNCRAGVQINDSGAALGYYVSEDGYPGWMPQKWTWIPRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSLNLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLKEVQEAVMLIEAGLSTYEKECAKRGDDYQEIFAQQVRETMERRAAGLKPPAWAAAAFESGLRQSTEEEKSDSRAA

Entity 5 Entity 5 polymer

Description description	Major capsid protein
Molecular weight formula_weight	38229.2 kDa
Source method src_method	nat
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A0,G0,C0,A1,G1,C1,A2,G2,C2,A3,G3,C3,A4,G4,C4

MSMYTTAQLLAANEQKFKFDPLFLRLFFRESYPFTTEKVYLSQIPGLVNMALYVSPIVSGEVIRSRGGSTSEFTPGYVKPKHEVNPQMTLRRLPDEDPQNLADPAYRRRRIIMQNMRDEELAIAQVEEMQAVSAVLKGKYTMTGEAFDPVEVDMGRSEENNITQSGGTEWSKRDKSTYDPTDDIEAYALNASGVVNIIVFDPKGWALFRSFKAVKEKLDTRRGSNSELETAVKDLGKAVSYKGMYGDVAIVVYSGQYVENGVKKNFLPDNTMVLGNTQARGLRTYGCIQDADAQREGINASARYPKNWVTTGDPAREFTMIQSAPLMLLADPDEFVSVQLA

Entity 6 Entity 6 polymer

Description description	Capsid decoration protein
Molecular weight formula_weight	11582.9 kDa
Source method src_method	nat
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H0,I0,J0,N0,H1,I1,J1,N1,H2,I2,J2,N2,H3,I3,J3,N3,H4,I4,J4,N4

MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.07 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	9851

Mature virion portal vertex of bacteriophage lambda

1. Protein Identity and Related Structures Protein Identity & Related Structures

Head-tail connector protein FII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Head completion protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tube terminator protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Portal protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid decoration protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8xqb__assembly_1__model_1

8xqb__assembly_1__model_1 | I(q)

8xqb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

7. Citations (1)