SAXSdb — 8iyd

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail tube protein

Escherichia phage lambda

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Tail tube terminator protein × 6 （P03732）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TUBE_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–246； UniProt 1–246 Author chain B； PDBConstruct 1–246； UniProt 1–246 Author chain C； PDBConstruct 1–246； UniProt 1–246 Author chain D； PDBConstruct 1–246； UniProt 1–246 Author chain E； PDBConstruct 1–246； UniProt 1–246 Author chain F； PDBConstruct 1–246； UniProt 1–246 Author chain H； PDBConstruct 1–246； UniProt 1–246 Author chain I； PDBConstruct 1–246； UniProt 1–246 Author chain J； PDBConstruct 1–246； UniProt 1–246 Author chain L； PDBConstruct 1–246； UniProt 1–246 Author chain M； PDBConstruct 1–246； UniProt 1–246 Author chain N； PDBConstruct 1–246； UniProt 1–246 Author chain O； PDBConstruct 1–246； UniProt 1–246 Author chain P； PDBConstruct 1–246； UniProt 1–246 Author chain R； PDBConstruct 1–246； UniProt 1–246 Author chain S； PDBConstruct 1–246； UniProt 1–246 Author chain T； PDBConstruct 1–246； UniProt 1–246 Author chain V； PDBConstruct 1–246； UniProt 1–246 Author chain X； PDBConstruct 1–246； UniProt 1–246 Author chain Y； PDBConstruct 1–246； UniProt 1–246 Author chain a； PDBConstruct 1–246； UniProt 1–246 Author chain b； PDBConstruct 1–246； UniProt 1–246 Author chain c； PDBConstruct 1–246； UniProt 1–246 Author chain v； PDBConstruct 1–246； UniProt 1–246

Tail tube terminator protein

Escherichia phage lambda

UniProt P03732

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Tail tube protein × 24 （P03733）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TTTP_LAMBD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–131； UniProt 1–131 Author chain K； PDBConstruct 1–131； UniProt 1–131 Author chain Q； PDBConstruct 1–131； UniProt 1–131 Author chain U； PDBConstruct 1–131； UniProt 1–131 Author chain W； PDBConstruct 1–131； UniProt 1–131 Author chain u； PDBConstruct 1–131； UniProt 1–131

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8iyd
Deposition date deposition_date	2023-04-04
Structure title title	Tail cap of phage lambda tail
Keywords keywords	;Bacteriophage, caudovirales, siphoviridae, tail complex, delivery device, macromolecular assembly, phage lambda, cryo-EM, VIRAL PROTEIN ;; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8iyd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8iyd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8iyd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	69.77 Å
Rg (electron density)	69.75 Å
Total Rg	69.77 Å
Atom count	49344
Residues	6639
Excluded volume	872480 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8iyd__assembly_1__model_1`	30-meric （30）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Tail tube protein
Molecular weight formula_weight	25831.8 kDa
Source method src_method	man
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,a,b,c,V,v,D,E,F,H,I,J,L,M,N,O,P,R,S,T,X,Y
Atom count atom_count	49344

MPVPNPTMPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTAESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAEDRSTVTAATGMTVTPASTSVVKGQSTTLTVAFQPEGVTDKSFRAVSADKTKATVSVSGMTITVNGVAAGKVNIPVVSGNGEFAAVAEITVTAS

Source Source

Source organism organism	Escherichia phage lambda
Common name common_name	Bacteriophage lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Tail tube terminator protein
Molecular weight formula_weight	14659.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,u,G,K,Q,W

MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM

Source Source

Source organism organism	Escherichia phage lambda
Common name common_name	Bacteriophage lambda
NCBI taxonomy ID ncbi_taxonomy_id	2681611
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	15959

Tail cap of phage lambda tail

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

Tail tube terminator protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8iyd__assembly_1__model_1

8iyd__assembly_1__model_1 | I(q)

8iyd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Tail cap of phage lambda tail

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tube terminator protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8iyd__assembly_1__model_1

8iyd__assembly_1__model_1 | I(q)

8iyd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)