SAXSdb — 8xow

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Head-tail connector protein FII

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain f； UniProt 1–117 Chain f1； UniProt 1–117 Chain f2； UniProt 1–117 Chain f3； UniProt 1–117 Chain f4； UniProt 1–117 Chain f5； UniProt 1–117	Not recorded	Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 3.32 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XOW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1K0H Solution structure of bacteriophage lambda gpFII Deposited 2001-09-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 200mM NaCl；Pressure ambient NMR sample composition 1.3mM gpFII U-15N, 13C; 10MM PHOSPHATE BUFFER NA, 200MM NACL \| 90% H2O/10% D2O	Resolution not provided
2KX4 Solution structure of Bacteriophage Lambda gpFII Deposited 2010-04-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 0.15；Pressure ambient NMR sample composition 1.5 mM [U-100% 13C; U-100% 15N] gpFII, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
8K37 Structure of the bacteriophage lambda neck Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain M 1–117（117 aa） Chain N 1–117（117 aa） Chain O 1–117（117 aa） Chain P 1–117（117 aa） Chain Q 1–117（117 aa） Chain R 1–117（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XPM Mature virion portal of phage lambda with DNA Deposited 2024-01-04	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 66 PDB declaration: 68-meric	Chain f 1–117（117 aa） Chain f1 1–117（117 aa） Chain f2 1–117（117 aa） Chain f3 1–117（117 aa） Chain f4 1–117（117 aa） Chain f5 1–117（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
8XQB Mature virion portal vertex of bacteriophage lambda Deposited 2024-01-05	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 71 PDB declaration: 71-meric	Chain f 1–117（117 aa） Chain f1 1–117（117 aa） Chain f2 1–117（117 aa） Chain f3 1–117（117 aa） Chain f4 1–117（117 aa） Chain f5 1–117（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.07 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FII_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain f； PDBConstruct 1–117； UniProt 1–117 Author chain f1； PDBConstruct 1–117； UniProt 1–117 Author chain f2； PDBConstruct 1–117； UniProt 1–117 Author chain f3； PDBConstruct 1–117； UniProt 1–117 Author chain f4； PDBConstruct 1–117； UniProt 1–117 Author chain f5； PDBConstruct 1–117； UniProt 1–117

Head completion protein

OrganismNot specified

UniProt P68660

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain W； UniProt 1–68 Chain W1； UniProt 1–68 Chain W2； UniProt 1–68 Chain W3； UniProt 1–68 Chain W4； UniProt 1–68 Chain W5； UniProt 1–68 Chain w； UniProt 1–68 Chain w1； UniProt 1–68 Chain w2； UniProt 1–68 Chain w3； UniProt 1–68 Chain w4； UniProt 1–68 Chain w5； UniProt 1–68	Not recorded	Head-tail connector protein FII × 6 （P03714） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 3.32 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XOW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1HYW SOLUTION STRUCTURE OF BACTERIOPHAGE LAMBDA GPW Deposited 2001-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 200mM NaCl；Pressure ambient NMR sample composition 1.5mM gpW U-15N, 13C; 10mM phosphate buffer NA, 200mM NaCl,90% H2O,10% D2O \| 90% H2O/10% D2O	Resolution not provided
8K38 The structure of bacteriophage lambda portal-adaptor Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain M 1–68（68 aa） Chain N 1–68（68 aa） Chain O 1–68（68 aa） Chain P 1–68（68 aa） Chain Q 1–68（68 aa） Chain R 1–68（68 aa） Chain S 1–68（68 aa） Chain T 1–68（68 aa） Chain U 1–68（68 aa） Chain V 1–68（68 aa） Chain W 1–68（68 aa） Chain X 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8XPM Mature virion portal of phage lambda with DNA Deposited 2024-01-04	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 66 PDB declaration: 68-meric	Chain W 1–68（68 aa） Chain W1 1–68（68 aa） Chain W2 1–68（68 aa） Chain W3 1–68（68 aa） Chain W4 1–68（68 aa） Chain W5 1–68（68 aa） Chain w 1–68（68 aa） Chain w1 1–68（68 aa） Chain w2 1–68（68 aa） Chain w3 1–68（68 aa） Chain w4 1–68（68 aa） Chain w5 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
8XQB Mature virion portal vertex of bacteriophage lambda Deposited 2024-01-05	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 71 PDB declaration: 71-meric	Chain W 1–68（68 aa） Chain W1 1–68（68 aa） Chain W2 1–68（68 aa） Chain W3 1–68（68 aa） Chain W4 1–68（68 aa） Chain W5 1–68（68 aa） Chain w 1–68（68 aa） Chain w1 1–68（68 aa） Chain w2 1–68（68 aa） Chain w3 1–68（68 aa） Chain w4 1–68（68 aa） Chain w5 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.07 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HCP_LAMBD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain W； PDBConstruct 1–68； UniProt 1–68 Author chain W1； PDBConstruct 1–68； UniProt 1–68 Author chain W2； PDBConstruct 1–68； UniProt 1–68 Author chain W3； PDBConstruct 1–68； UniProt 1–68 Author chain W4； PDBConstruct 1–68； UniProt 1–68 Author chain W5； PDBConstruct 1–68； UniProt 1–68 Author chain w； PDBConstruct 1–68； UniProt 1–68 Author chain w1； PDBConstruct 1–68； UniProt 1–68 Author chain w2； PDBConstruct 1–68； UniProt 1–68 Author chain w3； PDBConstruct 1–68； UniProt 1–68 Author chain w4； PDBConstruct 1–68； UniProt 1–68 Author chain w5； PDBConstruct 1–68； UniProt 1–68

Tail tube terminator protein

OrganismNot specified

UniProt P03732

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain U； UniProt 1–131 Chain U1； UniProt 1–131 Chain U2； UniProt 1–131 Chain U3； UniProt 1–131 Chain U4； UniProt 1–131 Chain U5； UniProt 1–131	Not recorded	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Portal protein B × 12 （P03710）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 3.32 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XOW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1Z1Z NMR structure of the gpu tail protein from lambda bacteriophage Deposited 2005-03-07	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–131（131 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.8；293 K；Ionic strength (raw mmCIF value) 50 mM KCl；Pressure 1 NMR sample composition 0.9 mM gpU, U-15N,13C, 10 mM Tris-d11, pH 7.8, 50 mM potassium chloride, 0.02% sodium azide, 10% D2O, 90% H2O \| 10% D2O, 90% H2O	Resolution not provided
3FZ2 Crystal structure of the tail terminator protein from phage lambda (gpU-D74A) Deposited 2009-01-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–131（131 aa） Chain B 1–131（131 aa） Chain E 1–131（131 aa） Chain F 1–131（131 aa） Chain I 1–131（131 aa） Chain K 1–131（131 aa）	Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Di-ammonium tartrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.283
3FZ2 Crystal structure of the tail terminator protein from phage lambda (gpU-D74A) Deposited 2009-01-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 1–131（131 aa） Chain D 1–131（131 aa） Chain G 1–131（131 aa） Chain H 1–131（131 aa） Chain J 1–131（131 aa） Chain L 1–131（131 aa）	Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Di-ammonium tartrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.283
3FZ2 Crystal structure of the tail terminator protein from phage lambda (gpU-D74A) Deposited 2009-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–131（131 aa） Chain B 1–131（131 aa） Chain C 1–131（131 aa） Chain D 1–131（131 aa） Chain E 1–131（131 aa） Chain F 1–131（131 aa） Chain G 1–131（131 aa） Chain H 1–131（131 aa） Chain I 1–131（131 aa） Chain J 1–131（131 aa） Chain K 1–131（131 aa） Chain L 1–131（131 aa）	Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Di-ammonium tartrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.283
3FZB Crystal structure of the tail terminator protein from phage lambda (gpU-WT) Deposited 2009-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 1–131（131 aa） Chain B 1–131（131 aa） Chain F 1–131（131 aa） Chain H 1–131（131 aa） Chain I 1–131（131 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Tri-sodium citrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.309
3FZB Crystal structure of the tail terminator protein from phage lambda (gpU-WT) Deposited 2009-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain C 1–131（131 aa） Chain D 1–131（131 aa） Chain E 1–131（131 aa） Chain G 1–131（131 aa） Chain J 1–131（131 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Tri-sodium citrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.309
8IYD Tail cap of phage lambda tail Deposited 2023-04-04	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain G 1–131（131 aa） Chain K 1–131（131 aa） Chain Q 1–131（131 aa） Chain U 1–131（131 aa） Chain W 1–131（131 aa） Chain u 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.10 Å
8K37 Structure of the bacteriophage lambda neck Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 1–131（131 aa） Chain B 1–131（131 aa） Chain C 1–131（131 aa） Chain D 1–131（131 aa） Chain E 1–131（131 aa） Chain F 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XPM Mature virion portal of phage lambda with DNA Deposited 2024-01-04	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 66 PDB declaration: 68-meric	Chain U 1–131（131 aa） Chain U1 1–131（131 aa） Chain U2 1–131（131 aa） Chain U3 1–131（131 aa） Chain U4 1–131（131 aa） Chain U5 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
8XQB Mature virion portal vertex of bacteriophage lambda Deposited 2024-01-05	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 71 PDB declaration: 71-meric	Chain U 1–131（131 aa） Chain U1 1–131（131 aa） Chain U2 1–131（131 aa） Chain U3 1–131（131 aa） Chain U4 1–131（131 aa） Chain U5 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.07 Å

7 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TTTP_LAMBD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain U； PDBConstruct 1–131； UniProt 1–131 Author chain U1； PDBConstruct 1–131； UniProt 1–131 Author chain U2； PDBConstruct 1–131； UniProt 1–131 Author chain U3； PDBConstruct 1–131； UniProt 1–131 Author chain U4； PDBConstruct 1–131； UniProt 1–131 Author chain U5； PDBConstruct 1–131； UniProt 1–131

Portal protein B

OrganismNot specified

UniProt P03710

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain B； UniProt 1–533 Chain B1； UniProt 1–533 Chain B2； UniProt 1–533 Chain B3； UniProt 1–533 Chain B4； UniProt 1–533 Chain B5； UniProt 1–533 Chain b； UniProt 1–533 Chain b1； UniProt 1–533 Chain b2； UniProt 1–533 Chain b3； UniProt 1–533 Chain b4； UniProt 1–533 Chain b5； UniProt 1–533	Not recorded	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 3.32 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XOW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8K38 The structure of bacteriophage lambda portal-adaptor Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 1–533（533 aa） Chain B 1–533（533 aa） Chain C 1–533（533 aa） Chain D 1–533（533 aa） Chain E 1–533（533 aa） Chain F 1–533（533 aa） Chain G 1–533（533 aa） Chain H 1–533（533 aa） Chain I 1–533（533 aa） Chain J 1–533（533 aa） Chain K 1–533（533 aa） Chain L 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8K39 Structure of the bacteriophage lambda portal vertex Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain U 1–533（533 aa） Chain V 1–533（533 aa） Chain W 1–533（533 aa） Chain X 1–533（533 aa） Chain Y 1–533（533 aa） Chain Z 1–533（533 aa） Chain a 1–533（533 aa） Chain b 1–533（533 aa） Chain c 1–533（533 aa） Chain d 1–533（533 aa） Chain e 1–533（533 aa） Chain f 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8XOT Prohead portal of bacteriophage lambda Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain B 1–533（533 aa） Chain B1 1–533（533 aa） Chain B2 1–533（533 aa） Chain B3 1–533（533 aa） Chain B4 1–533（533 aa） Chain B5 1–533（533 aa） Chain b 1–533（533 aa） Chain b1 1–533（533 aa） Chain b2 1–533（533 aa） Chain b3 1–533（533 aa） Chain b4 1–533（533 aa） Chain b5 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.51 Å
8XOU Prohead portal vertex of bacteriophage lambda Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain B 1–533（533 aa） Chain B1 1–533（533 aa） Chain B2 1–533（533 aa） Chain B3 1–533（533 aa） Chain B4 1–533（533 aa） Chain B5 1–533（533 aa） Chain b 1–533（533 aa） Chain b1 1–533（533 aa） Chain b2 1–533（533 aa） Chain b3 1–533（533 aa） Chain b4 1–533（533 aa） Chain b5 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.58 Å
8XPM Mature virion portal of phage lambda with DNA Deposited 2024-01-04	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 66 PDB declaration: 68-meric	Chain B 1–533（533 aa） Chain B1 1–533（533 aa） Chain B2 1–533（533 aa） Chain B3 1–533（533 aa） Chain B4 1–533（533 aa） Chain B5 1–533（533 aa） Chain b 1–533（533 aa） Chain b1 1–533（533 aa） Chain b2 1–533（533 aa） Chain b3 1–533（533 aa） Chain b4 1–533（533 aa） Chain b5 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
8XQB Mature virion portal vertex of bacteriophage lambda Deposited 2024-01-05	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 71 PDB declaration: 71-meric	Chain B 1–533（533 aa） Chain B1 1–533（533 aa） Chain B2 1–533（533 aa） Chain B3 1–533（533 aa） Chain B4 1–533（533 aa） Chain B5 1–533（533 aa） Chain b 1–533（533 aa） Chain b1 1–533（533 aa） Chain b2 1–533（533 aa） Chain b3 1–533（533 aa） Chain b4 1–533（533 aa） Chain b5 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.07 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PORTL_LAMBD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–533； UniProt 1–533 Author chain B1； PDBConstruct 1–533； UniProt 1–533 Author chain B2； PDBConstruct 1–533； UniProt 1–533 Author chain B3； PDBConstruct 1–533； UniProt 1–533 Author chain B4； PDBConstruct 1–533； UniProt 1–533 Author chain B5； PDBConstruct 1–533； UniProt 1–533 Author chain b； PDBConstruct 1–533； UniProt 1–533 Author chain b1； PDBConstruct 1–533； UniProt 1–533 Author chain b2； PDBConstruct 1–533； UniProt 1–533 Author chain b3； PDBConstruct 1–533； UniProt 1–533 Author chain b4； PDBConstruct 1–533； UniProt 1–533 Author chain b5； PDBConstruct 1–533； UniProt 1–533

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8xow
Deposition date deposition_date	2024-01-02
Structure title title	Mature virion portal of bacteriophage lambda
Keywords keywords	;caudovirales, siphoviridae, portal vertex, portal, capsid, connector/neck, tail, delivery device, B-DNA, phage lambda, VIRAL PROTEIN ;; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	68.38 Å
Radius of gyration Rg (electron density) rg_electron	68.49 Å
Forward intensity I(0) i0	11871400000.00
Molecular weight molecular_weight	886080.0 kDa
Excluded volume excluded_volume	1092500 Å³
Envelope volume envelope_volume	1544400 Å³
Hydration-shell volume shell_volume	185350 Å³
Envelope diameter envelope_diameter	223.5 Å
Shell Rg shell_rg	71.88 Å
Envelope Rg envelope_rg	67.43 Å
Shape Rg shape_rg	68.53 Å
Total Rg total_rg	68.38 Å
Total atoms total_atoms	62334
Residues n_residues	7962
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	205.1 Å
Rg (real space) rg_real	68.39 Å
Rg uncertainty (real space) rg_real_error	1.20 Å
I(0) (real space) i0_real	1.1870e+10
I(0) uncertainty (real space) i0_real_error	2.3040e+08
Rg (reciprocal space) rg_reciprocal	68.19 Å
I(0) (reciprocal space) i0_reciprocal	11870000000.0000
Solution quality estimate total_estimate	0.8364
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	80.3 Å
Skewness Skewness skewness	0.390
Kurtosis Kurtosis kurtosis	-0.359
Angular range angular_range	— – 0.1150 Å⁻¹
Current regularization parameter α current_alpha	0.0004
Highest regularization parameter α highest_alpha	1845000000.0000
Real-space data points n_real_points	24
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.958; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.985; Smooth: 0.010

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Head-tail connector protein FII
Molecular weight formula_weight	12775.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,f1,f2,f3,f4,f5
Atom count atom_count	62334

MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR

Entity 2 Entity 2 polymer

Description description	Head completion protein
Molecular weight formula_weight	7625.7 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,w,W1,w1,W2,w2,W3,w3,W4,w4,W5,w5

MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRGPAGFYV

Entity 3 Entity 3 polymer

Description description	Tail tube terminator protein
Molecular weight formula_weight	14659.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,U1,U2,U3,U4,U5

MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM

Entity 4 Entity 4 polymer

Description description	Portal protein B
Molecular weight formula_weight	59529.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b,B1,b1,B2,b2,B3,b3,B4,b4,B5,b5

MKTPTIPTLLGPDGMTSLREYAGYHGGGSGFGGQLRSWNPPSESVDAALLPNFTRGNARADDLVRNNGYAANAIQLHQDHIVGSFFRLSHRPSWRYLGIGEEEARAFSREVEAAWKEFAEDDCCCIDVERKRTFTMMIREGVAMHAFNGELFVQATWDTSSSRLFRTQFRMVSPKRISNPNNTGDSRNCRAGVQINDSGAALGYYVSEDGYPGWMPQKWTWIPRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSLNLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLKEVQEAVMLIEAGLSTYEKECAKRGDDYQEIFAQQVRETMERRAAGLKPPAWAAAAFESGLRQSTEEEKSDSRAA

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.32 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	19791

fit	/app/data/saxs_computation/xo/8xow/8xow.fit
pddf	/app/data/pr_computation/xo/8xow/8xow.pr.out
profile	/app/data/saxs_computation/xo/8xow/8xow.dat

Mature virion portal of bacteriophage lambda

1. Protein Identity and Related Structures Protein Identity & Related Structures

Head-tail connector protein FII

State in the Current Structure

Other States of the Same Protein in the Database

Head completion protein

State in the Current Structure

Other States of the Same Protein in the Database

Tail tube terminator protein

State in the Current Structure

Other States of the Same Protein in the Database

Portal protein B

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)