SAXSdb — 7xme

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polymerase basic protein 2

Influenza A virus (A/Victoria/3/1975(H3N2))

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 318–483	Not recorded	IOD IODIDE ION × 1 GIH (2~{S},3~{S})-3-[[5-dimethoxyphosphoryl-4-(5-fluoranyl-1~{H}-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-2-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；277.15 K；Soudium,BIS-Tris propane pH 8.5,PEG3350	Resolution 2.52 Å R-free 0.330
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 318–483	Not recorded	IOD IODIDE ION × 1 GIH (2~{S},3~{S})-3-[[5-dimethoxyphosphoryl-4-(5-fluoranyl-1~{H}-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-2-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；277.15 K；Soudium,BIS-Tris propane pH 8.5,PEG3350	Resolution 2.52 Å R-free 0.330
3	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain C； UniProt 318–483	Not recorded	IOD IODIDE ION × 1 GIH (2~{S},3~{S})-3-[[5-dimethoxyphosphoryl-4-(5-fluoranyl-1~{H}-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-2-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；277.15 K；Soudium,BIS-Tris propane pH 8.5,PEG3350	Resolution 2.52 Å R-free 0.330
4	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain D； UniProt 318–483	Not recorded	IOD IODIDE ION × 1 GIH (2~{S},3~{S})-3-[[5-dimethoxyphosphoryl-4-(5-fluoranyl-1~{H}-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-2-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；277.15 K；Soudium,BIS-Tris propane pH 8.5,PEG3350	Resolution 2.52 Å R-free 0.330

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7XME	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2GMO NMR-structure of an independently folded C-terminal domain of influenza polymerase subunit PB2 Deposited 2006-04-07	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 678–759（82 aa） Fragment：PB2 C-terminal 678-759 fragment	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；283 K；Ionic strength (raw mmCIF value) 200 mM NaCl；Pressure ambient NMR sample composition 50 mM Tris buffer pH 7.5, 200 mM NaCl, 1 mM EDTA, 0.01% NaN3, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 50 mM Tris buffer pH 7.5, 200 mM NaCl, 1 mM EDTA, 0.01% NaN3, 100% D2O \| 100% D2O	Resolution not provided
2JDQ C-terminal domain of influenza A virus polymerase PB2 subunit in complex with human importin alpha5 Deposited 2007-01-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 678–759（82 aa） Fragment：C-TERMINAL DOMAIN, RESIDUES 678-759	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；1 MICROLITRE OF PROTEIN SOLUTION, AT 20 MG/ML IN 30 MM TRIS-HCL, PH 7.5, 150 MM NACL, 3 MM BETA-MERCAPTOETHANOL WAS MIXED WITH AN EQUAL VOLUME OF RESERVOIR SOLUTION (0.1 M NAAC, PH 4.6, 5 MM CACL2, 15% MPD)	Resolution 2.20 Å R-free 0.247
2JDQ C-terminal domain of influenza A virus polymerase PB2 subunit in complex with human importin alpha5 Deposited 2007-01-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 678–759（82 aa） Fragment：C-TERMINAL DOMAIN, RESIDUES 678-759	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；1 MICROLITRE OF PROTEIN SOLUTION, AT 20 MG/ML IN 30 MM TRIS-HCL, PH 7.5, 150 MM NACL, 3 MM BETA-MERCAPTOETHANOL WAS MIXED WITH AN EQUAL VOLUME OF RESERVOIR SOLUTION (0.1 M NAAC, PH 4.6, 5 MM CACL2, 15% MPD)	Resolution 2.20 Å R-free 0.247
2VQZ Structure of the cap-binding domain of influenza virus polymerase subunit PB2 with bound m7GTP Deposited 2008-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 318–483（166 aa） Fragment：CAP-BINDING DOMAIN, RESIDUES 318-483 Chain B 318–483（166 aa） Fragment：CAP-BINDING DOMAIN, RESIDUES 318-483 Chain D 318–483（166 aa） Fragment：CAP-BINDING DOMAIN, RESIDUES 318-483 Chain E 318–483（166 aa） Fragment：CAP-BINDING DOMAIN, RESIDUES 318-483 Chain F 318–483（166 aa） Fragment：CAP-BINDING DOMAIN, RESIDUES 318-483	Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF)	MGT 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；1 MICROLITRE OF PROTEIN SOLUTION AT 11 MG PER ML IN 50 MM TRIS-HCL (PH 8.0), 200 MM NACL, 2 MM DTT, 5 MM M7GTP WITH AN EQUAL VOLUME OF A SOLUTION CONTAINING 0.1 M CITRIC ACID PH 4.6, 1.6-1.8 M SODIUM FORMATE.	Resolution 2.30 Å R-free 0.235
2VY6 Two domains from the C-terminal region of influenza A virus polymerase PB2 subunit Deposited 2008-07-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 538–753（216 aa） Fragment：627- AND NLS-DOMAINS, RESIDUES 538-753	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 1 MICROLITRE OF 5.5 MG/ML PROTEIN SOLUTION IN 10 MM TRIS-HCL PH 7.0 AND 200 MM NACL WITH EQUAL VOLUME OF 100 MM HEPES PH 7.5 AND K/NA TARTRATE AT 1.2 M.	Resolution 1.95 Å R-free 0.258
2VY7 The 627-domain from influenza A virus polymerase PB2 subunit Deposited 2008-07-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 538–693（156 aa） Fragment：627- DOMAIN, RESIDUES 538-693	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 1 MICROLITRE OF 2.4 MG/ML PROTEIN SOLUTION IN 10 MM TRIS-HCL PH 7.0 AND 200 MM NACL WITH 1 MICROLITRE OF 100 MM CITRIC ACID PH 4.0-7.0 AND 1.4-1.6 M AMMONIUM SULFATE SOLUTION	Resolution 1.53 Å R-free 0.185
2VY8 The 627-domain from influenza A virus polymerase PB2 subunit with Glu- 627 Deposited 2008-07-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 538–693（156 aa） Fragment：627-DOMAIN, RESIDUES 538-693	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 1 MICROLITRE OF 2.4 MG/ML PROTEIN SOLUTION IN 10 MM TRIS-HCL PH 7.0 AND 200 MM NACL WITH 1 MICROLITRE OF 100 MM CITRIC ACID PH 4.0-7.0 AND 1.4-1.6 M AMMONIUM SULFATE SOLUTION	Resolution 1.20 Å R-free 0.214
4NCE Influenza polymerase basic protein 2 (PB2) bound to 7-methyl-GTP Deposited 2013-10-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 317–483（167 aa） Fragment：CAP-BINDING DOMAIN	Mutation：R389K	MGT 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 11H 9,10-dioxo-9,10-dihydroanthracene-2,6-disulfonic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.7；298 K；0.7 uL of protein solution (9.7 mg/mL protein, 50 mM Tris buffer pH 8, 200 mM sodium chloride, 2 mM dithiothreitol, 5 mM m7GTP) was mixed with 0.35 uL Hampton Research Silver Bullet screening reagent #36. This mixture was combined with 0.35 uL of well solution (approximately 1.3 M sodium formate, 100 mM sodium citrate buffer pH 4.6, 5 mM dithiothreitol) and suspended over 1 mL of well solution, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.30 Å R-free 0.229
4NCM Influenza polymerase basic protein 2 (PB2) bound to a small-molecule inhibitor Deposited 2013-10-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 317–483（167 aa） Fragment：CAP-BINDING DOMAIN	Mutation：R389K	704 N~2~-[2-(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-yl)-5-fluoropyrimidin-4-yl]-N,N-dimethyl-L-alaninamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.7；298 K；0.7 uL of protein solution (9.7 mg/mL protein, 50 mM Tris buffer pH 8, 200 mM sodium chloride, 2 mM dithiothreitol, 5 mM m7GTP) was mixed with 0.35 uL Hampton Research Silver Bullet screening reagent #36. This mixture was combined with 0.35 uL of well solution (approximately 1.3 M sodium formate, 100 mM sodium citrate buffer pH 4.6, 5 mM dithiothreitol) and suspended over 1 mL of well solution, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.82 Å R-free 0.191
4P1U Influenza A (flu) virus polymerase basic protein 2 (PB2) bound to VX787, an azaindole inhibitor Deposited 2014-02-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 318–483（166 aa）	Not recorded	21G (2S,3S)-3-[[5-fluoranyl-2-(5-fluoranyl-1H-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-4-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.7；293 K；1 ?L protein solution (2.8 mg/ml protein, 50 mM Tris buffer pH 8, 200 mM sodium chloride, 2 mM dithiothreitol, 1 mM anthraquinone-2,6-disulfonic acid disodium salt, 7.5 mM GTP) and 0.4 ?L well solution (1.5 M sodium formate, 100 mM sodium citrate buffer pH 4.7, 10 mM dithiothreitol) was suspended over 1 mL of well solution. The crystals were transferred to a soaking solution (3.25 M sodium formate, 100 mM sodium citrate buffer pH 4.7) containing 1 mM VRT-0928787. Crystals were incubated approximately 15 hours t room temperature, and then transferred to a cryo-preservative solution (soaking solution with 25 % v/v glycerol) prior to freezing in liquid nitrogen.	Resolution 2.52 Å R-free 0.243
4UAD Importin alpha 7 delta IBB in complex with Influenza PB2 Nuclear Localization Domain Deposited 2014-08-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 683–759（77 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.2 M magnesium acetate 12% PEG 8000 0.1M Na cacodylate at pH 6.5	Resolution 2.42 Å R-free 0.231
4UAE Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain Deposited 2014-08-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 678–759（82 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.1 M Na cacodylate, pH 6.5 0.1 M NaCl 1.1 M ammonium sulfate	Resolution 2.70 Å R-free 0.239
4UAF Importin alpha 1 delta IBB in complex with Influenza PB2 nuclear localization domain Deposited 2014-08-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 678–759（82 aa）	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.49 M Na phosphate monobasic 0.91 M K phosphate dibasic pH 6.9	Resolution 1.70 Å R-free 0.193
6EUV Structure of the midlink and cap-binding domains of influenza A polymerase PB2 subunit with a bound azaindole cap-binding inhibitor (VX-787) Deposited 2017-10-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 247–536（290 aa）	Not recorded	21G (2S,3S)-3-[[5-fluoranyl-2-(5-fluoranyl-1H-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-4-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 2 NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；Crystals were obtained by mixing protein at 16 mg per mL mixed with 2 mM VX-787 in 0.1 M MES pH6, 0.7 M sodium formate pH 6.	Resolution 2.70 Å R-free 0.282
6EUV Structure of the midlink and cap-binding domains of influenza A polymerase PB2 subunit with a bound azaindole cap-binding inhibitor (VX-787) Deposited 2017-10-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 247–536（290 aa）	Not recorded	21G (2S,3S)-3-[[5-fluoranyl-2-(5-fluoranyl-1H-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-4-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 2 NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；Crystals were obtained by mixing protein at 16 mg per mL mixed with 2 mM VX-787 in 0.1 M MES pH6, 0.7 M sodium formate pH 6.	Resolution 2.70 Å R-free 0.282
6EUV Structure of the midlink and cap-binding domains of influenza A polymerase PB2 subunit with a bound azaindole cap-binding inhibitor (VX-787) Deposited 2017-10-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 247–536（290 aa）	Not recorded	21G (2S,3S)-3-[[5-fluoranyl-2-(5-fluoranyl-1H-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-4-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1 NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；Crystals were obtained by mixing protein at 16 mg per mL mixed with 2 mM VX-787 in 0.1 M MES pH6, 0.7 M sodium formate pH 6.	Resolution 2.70 Å R-free 0.282
6EUV Structure of the midlink and cap-binding domains of influenza A polymerase PB2 subunit with a bound azaindole cap-binding inhibitor (VX-787) Deposited 2017-10-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 247–536（290 aa）	Not recorded	21G (2S,3S)-3-[[5-fluoranyl-2-(5-fluoranyl-1H-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-4-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1 NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；Crystals were obtained by mixing protein at 16 mg per mL mixed with 2 mM VX-787 in 0.1 M MES pH6, 0.7 M sodium formate pH 6.	Resolution 2.70 Å R-free 0.282
6EUY Structure of the midlink and cap-binding domains of influenza A polymerase PB2 subunit with a bound azaindazole cap-binding inhibitor Deposited 2017-10-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 247–536（290 aa）	Not recorded	BYB (2~{S},3~{S})-3-[[5-fluoranyl-2-(5-fluoranyl-1~{H}-pyrazolo[3,4-b]pyridin-3-yl)pyrimidin-4-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Crystals were obtained with A/H3N2 double domain at 15 mg/ml in 20 mM Tris pH 8, 150 mM NaCl, 5% glycerol, 2 mM beta-mercaptoethanolmixed with 5 mM of VX-787 mixed with 0.2 M ammonium sulphate, 20% PEG3350	Resolution 3.00 Å R-free 0.263
6EUY Structure of the midlink and cap-binding domains of influenza A polymerase PB2 subunit with a bound azaindazole cap-binding inhibitor Deposited 2017-10-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 247–536（290 aa）	Not recorded	BYB (2~{S},3~{S})-3-[[5-fluoranyl-2-(5-fluoranyl-1~{H}-pyrazolo[3,4-b]pyridin-3-yl)pyrimidin-4-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Crystals were obtained with A/H3N2 double domain at 15 mg/ml in 20 mM Tris pH 8, 150 mM NaCl, 5% glycerol, 2 mM beta-mercaptoethanolmixed with 5 mM of VX-787 mixed with 0.2 M ammonium sulphate, 20% PEG3350	Resolution 3.00 Å R-free 0.263
6EUY Structure of the midlink and cap-binding domains of influenza A polymerase PB2 subunit with a bound azaindazole cap-binding inhibitor Deposited 2017-10-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 247–536（290 aa）	Not recorded	BYB (2~{S},3~{S})-3-[[5-fluoranyl-2-(5-fluoranyl-1~{H}-pyrazolo[3,4-b]pyridin-3-yl)pyrimidin-4-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Crystals were obtained with A/H3N2 double domain at 15 mg/ml in 20 mM Tris pH 8, 150 mM NaCl, 5% glycerol, 2 mM beta-mercaptoethanolmixed with 5 mM of VX-787 mixed with 0.2 M ammonium sulphate, 20% PEG3350	Resolution 3.00 Å R-free 0.263
9V44 Coupling of polymerase-nucleoprotein-RNA in an influenza virus mini ribonucleoprotein complex Deposited 2025-05-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
9V46 Coupling of polymerase-nucleoprotein-RNA in an influenza virus mini ribonucleoprotein complex Deposited 2025-05-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 1–759（759 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å

16 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PB2_I75A3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–166； UniProt 318–483 Author chain B； PDBConstruct 1–166； UniProt 318–483 Author chain C； PDBConstruct 1–166； UniProt 318–483 Author chain D； PDBConstruct 1–166； UniProt 318–483

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7xme
Deposition date deposition_date	2022-04-25
Structure title title	Structure of Influenza A virus polymerase basic protein 2 (PB2) with an azazindole derivative
Keywords keywords	Inhibitor, Complex, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	32.20 Å
Radius of gyration Rg (electron density) rg_electron	31.93 Å
Forward intensity I(0) i0	83760400.00
Molecular weight molecular_weight	71315.0 kDa
Excluded volume excluded_volume	88804 Å³
Envelope volume envelope_volume	115540 Å³
Hydration-shell volume shell_volume	31637 Å³
Envelope diameter envelope_diameter	112.8 Å
Shell Rg shell_rg	36.80 Å
Envelope Rg envelope_rg	31.58 Å
Shape Rg shape_rg	31.91 Å
Total Rg total_rg	32.41 Å
Total atoms total_atoms	5053
Residues n_residues	618
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	109.2 Å
Rg (real space) rg_real	32.33 Å
Rg uncertainty (real space) rg_real_error	0.79 Å
I(0) (real space) i0_real	8.3760e+07
I(0) uncertainty (real space) i0_real_error	1.3980e+06
Rg (reciprocal space) rg_reciprocal	32.28 Å
I(0) (reciprocal space) i0_reciprocal	83760000.0000
Solution quality estimate total_estimate	0.8690
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	0
Primary peak position r_peak_primary	— Å
Skewness Skewness skewness	0.376
Kurtosis Kurtosis kurtosis	-0.352
Angular range angular_range	— – 0.2450 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	14420000.0000
Real-space data points n_real_points	50
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.863; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.902; Smooth: 0.801

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Polymerase basic protein 2
Molecular weight formula_weight	18875.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	5107

RISSSFSFGGFTFKRTSGSSIKREEEVLTGNLQTLKIRVHEGYEEFTMVGKRATAILRKATRRLVQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEHIDNVMGMVGVLPDMTPSTEMSMRGIRVSKM

来源 Source

来源生物 organism	Influenza A virus (A/Victoria/3/1975(H3N2))
NCBI Class编号 ncbi_taxonomy_id	392809
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	IODIDE ION
Molecular weight formula_weight	126.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	;(2~{S},3~{S})-3-[[5-dimethoxyphosphoryl-4-(5-fluoranyl-1~{H}-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-2-yl]amino]bicyclo[2.2.2]octane-2-carboxylic acid ;
Molecular weight formula_weight	489.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	54

▶

8. Citations (1)

▶

Unit-cell length a length_a	176.791 Å
Unit-cell length b length_b	31.306 Å
Unit-cell length c length_c	114.552 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.31 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.521 Å
Low-resolution limit resolution_low	45.958 Å
R factor r_factor	0.2539
R_work r_work	0.2501
R_free r_free	0.3297

fit	/app/data/saxs_computation/xm/7xme/7xme.fit
pddf	/app/data/pr_computation/xm/7xme/7xme.pr.out
profile	/app/data/saxs_computation/xm/7xme/7xme.dat

Structure of Influenza A virus polymerase basic protein 2 (PB2) with an azazindole derivative

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polymerase basic protein 2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction