SAXSdb — 8adl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Maintenance of telomere capping protein 5

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 22 PDB declaration: 22-meric（22） Consistent with protein copy count	Chain C； UniProt 1–1148 Chain Q； UniProt 1–1148	Not recorded	Nucleoporin SEH1 × 6 （P53011） SEH-associated protein 4 × 4 （P38164） Protein transport protein SEC13 × 2 （Q04491） Restriction of telomere capping protein 1 × 2 （Q08281） Nitrogen permease regulator 3 × 2 （P38742） Vacuolar membrane-associated protein IML1 × 2 （P47170） Nitrogen permease regulator 2 × 2 （P39923） ZN ZINC ION × 28	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.95 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ADL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AE6 Cryo-EM structure of the SEA complex wing (SEACIT) Deposited 2022-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain Q 1–1148（1148 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9H4Q Cryo-EM structure of the SEAC wing - EGOC Deposited 2024-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 1–1148（1148 aa）	Not recorded	MG MAGNESIUM ION × 1 AF3 ALUMINUM FLUORIDE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9H5K Cryo-EM structure of the SEAC-EGOC supercomplex Deposited 2024-10-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain C 1–1148（1148 aa） Chain K 1–1148（1148 aa）	Not recorded	ZN ZINC ION × 28 MG MAGNESIUM ION × 2 AF3 ALUMINUM FLUORIDE × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	WDR59_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–1148； UniProt 1–1148 Author chain Q； PDBConstruct 1–1148； UniProt 1–1148

Nucleoporin SEH1

OrganismNot specified

UniProt P53011

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 22 PDB declaration: 22-meric（22） Consistent with protein copy count	Chain D； UniProt 1–349 Chain E； UniProt 1–349 Chain F； UniProt 1–349 Chain L； UniProt 1–349 Chain M； UniProt 1–349 Chain N； UniProt 1–349	Not recorded	Maintenance of telomere capping protein 5 × 2 （Q03897） SEH-associated protein 4 × 4 （P38164） Protein transport protein SEC13 × 2 （Q04491） Restriction of telomere capping protein 1 × 2 （Q08281） Nitrogen permease regulator 3 × 2 （P38742） Vacuolar membrane-associated protein IML1 × 2 （P47170） Nitrogen permease regulator 2 × 2 （P39923） ZN ZINC ION × 28	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.95 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ADL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3EWE Crystal Structure of the Nup85/Seh1 Complex Deposited 2008-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–349（349 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；289 K；18% PEG 3350, 0.1M Bis Tris propane, 0.2M Sodium Citrate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 3.50 Å R-free 0.369
3EWE Crystal Structure of the Nup85/Seh1 Complex Deposited 2008-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–349（349 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；289 K；18% PEG 3350, 0.1M Bis Tris propane, 0.2M Sodium Citrate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 3.50 Å R-free 0.369
3EWE Crystal Structure of the Nup85/Seh1 Complex Deposited 2008-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa） Chain C 1–349（349 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；289 K；18% PEG 3350, 0.1M Bis Tris propane, 0.2M Sodium Citrate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 3.50 Å R-free 0.369
3F3F Crystal structure of the nucleoporin pair Nup85-Seh1, space group P21 Deposited 2008-10-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–349（349 aa） Chain B 1–349（349 aa） Chain E 1–349（349 aa） Chain F 1–349（349 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.1；298 K；PEG 10000, MES buffer, pH 6.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.90 Å R-free 0.265
3F3G Crystal structure of the nucleoporin pair Nup85-Seh1, space group P212121 Deposited 2008-10-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–349（349 aa） Chain B 1–349（349 aa） Chain E 1–349（349 aa） Chain F 1–349（349 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Sodium citrate, Sodium chloride, Tris-HCl buffer, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.75 Å R-free 0.272
3F3P Crystal structure of the nucleoporin pair Nup85-Seh1, space group P21212 Deposited 2008-10-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–349（349 aa） Chain B 1–349（349 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；PEG 3350, Tacsimate pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.281
3F3P Crystal structure of the nucleoporin pair Nup85-Seh1, space group P21212 Deposited 2008-10-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–349（349 aa） Chain F 1–349（349 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；PEG 3350, Tacsimate pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.281
3F3P Crystal structure of the nucleoporin pair Nup85-Seh1, space group P21212 Deposited 2008-10-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain I 1–349（349 aa） Chain J 1–349（349 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；PEG 3350, Tacsimate pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.281
4XMM Structure of the yeast coat nucleoporin complex, space group C2 Deposited 2015-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–349（349 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；PEG 20000, ethanol, MES	Resolution 7.38 Å R-free 0.353
6X08 Nup85-Seh1 from S. cerevisiae bound by VHH-SAN2 Deposited 2020-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–349（349 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；1M ammonium sulfate, di-sodium succinate pH 5.5, and the addition of 4% 1-propanol	Resolution 4.19 Å R-free 0.346
7N84 Double nuclear outer ring from the isolated yeast NPC Deposited 2021-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 136 PDB declaration: 136-meric	Chain e 1–349（349 aa） Chain p 1–349（349 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.60 Å
7N84 Double nuclear outer ring from the isolated yeast NPC Deposited 2021-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain e 1–349（349 aa） Chain p 1–349（349 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.60 Å
7N84 Double nuclear outer ring from the isolated yeast NPC Deposited 2021-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain e 1–349（349 aa） Chain p 1–349（349 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.60 Å
7N9F Structure of the in situ yeast NPC Deposited 2021-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 448 PDB declaration: 448-meric	Chain e 1–349（349 aa） Chain l 1–349（349 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；A custom-built vitrification device (Max Planck Institute for Biochemistry, Munich)	Resolution 37.00 Å
7N9F Structure of the in situ yeast NPC Deposited 2021-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain e 1–349（349 aa） Chain l 1–349（349 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；A custom-built vitrification device (Max Planck Institute for Biochemistry, Munich)	Resolution 37.00 Å
7N9F Structure of the in situ yeast NPC Deposited 2021-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain e 1–349（349 aa） Chain l 1–349（349 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；A custom-built vitrification device (Max Planck Institute for Biochemistry, Munich)	Resolution 37.00 Å
9H5K Cryo-EM structure of the SEAC-EGOC supercomplex Deposited 2024-10-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain D 1–349（349 aa） Chain E 1–349（349 aa） Chain F 1–349（349 aa） Chain L 1–349（349 aa） Chain M 1–349（349 aa） Chain N 1–349（349 aa）	Not recorded	ZN ZINC ION × 28 MG MAGNESIUM ION × 2 AF3 ALUMINUM FLUORIDE × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

9 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SEH1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–349； UniProt 1–349 Author chain E； PDBConstruct 1–349； UniProt 1–349 Author chain F； PDBConstruct 1–349； UniProt 1–349 Author chain L； PDBConstruct 1–349； UniProt 1–349 Author chain M； PDBConstruct 1–349； UniProt 1–349 Author chain N； PDBConstruct 1–349； UniProt 1–349

SEH-associated protein 4

OrganismNot specified

UniProt P38164

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 22 PDB declaration: 22-meric（22） Consistent with protein copy count	Chain B； UniProt 1–1038 Chain G； UniProt 1–1038 Chain J； UniProt 1–1038 Chain O； UniProt 1–1038	Not recorded	Maintenance of telomere capping protein 5 × 2 （Q03897） Nucleoporin SEH1 × 6 （P53011） Protein transport protein SEC13 × 2 （Q04491） Restriction of telomere capping protein 1 × 2 （Q08281） Nitrogen permease regulator 3 × 2 （P38742） Vacuolar membrane-associated protein IML1 × 2 （P47170） Nitrogen permease regulator 2 × 2 （P39923） ZN ZINC ION × 28	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.95 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ADL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9H5K Cryo-EM structure of the SEAC-EGOC supercomplex Deposited 2024-10-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain B 1–1038（1038 aa） Chain G 1–1038（1038 aa） Chain J 1–1038（1038 aa） Chain O 1–1038（1038 aa）	Not recorded	ZN ZINC ION × 28 MG MAGNESIUM ION × 2 AF3 ALUMINUM FLUORIDE × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SEA4_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–1038； UniProt 1–1038 Author chain G； PDBConstruct 1–1038； UniProt 1–1038 Author chain J； PDBConstruct 1–1038； UniProt 1–1038 Author chain O； PDBConstruct 1–1038； UniProt 1–1038

Protein transport protein SEC13

OrganismNot specified

UniProt Q04491

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 22 PDB declaration: 22-meric（22） Consistent with protein copy count	Chain H； UniProt 1–297 Chain P； UniProt 1–297	Not recorded	Maintenance of telomere capping protein 5 × 2 （Q03897） Nucleoporin SEH1 × 6 （P53011） SEH-associated protein 4 × 4 （P38164） Restriction of telomere capping protein 1 × 2 （Q08281） Nitrogen permease regulator 3 × 2 （P38742） Vacuolar membrane-associated protein IML1 × 2 （P47170） Nitrogen permease regulator 2 × 2 （P39923） ZN ZINC ION × 28	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.95 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ADL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2PM6 Crystal Structure of yeast Sec13/31 edge element of the COPII vesicular coat, native version Deposited 2007-04-20	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–297（297 aa） Chain D 1–297（297 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；15% PEG 4000, 10% DMSO, 6% dioxanie, 0.1M Tris-HCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.45 Å R-free 0.301
2PM7 Crystal structure of yeast Sec13/31 edge element of the COPII vesicular coat, selenomethionine version Deposited 2007-04-20	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–297（297 aa） Chain D 1–297（297 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；15% PEG 4000, 10% DMSO, 6% dioxane, 0.1M Tris-HCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.35 Å R-free 0.298
2PM9 Crystal structure of yeast Sec13/31 vertex element of the COPII vesicular coat Deposited 2007-04-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–297（297 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；295 K；8% PEG 3350, 0.1M tri-sodium citrate, 10mM manganese chloride, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.30 Å R-free 0.305
3IKO Crystal structure of the heterotrimeric Sec13-Nup145C-Nup84 nucleoporin complex Deposited 2009-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–297（297 aa） Fragment：UNP residues 1-297	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；PEG 20000, MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.20 Å R-free 0.273
3IKO Crystal structure of the heterotrimeric Sec13-Nup145C-Nup84 nucleoporin complex Deposited 2009-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1–297（297 aa） Fragment：UNP residues 1-297	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；PEG 20000, MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.20 Å R-free 0.273
3IKO Crystal structure of the heterotrimeric Sec13-Nup145C-Nup84 nucleoporin complex Deposited 2009-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1–297（297 aa） Fragment：UNP residues 1-297	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；PEG 20000, MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.20 Å R-free 0.273
3JRO NUP84-NUP145C-SEC13 edge element of the NPC lattice Deposited 2009-09-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–297（297 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.7；295 K；1.15M sodium malonate, pH 5.7, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 4.00 Å R-free 0.329
3JRP SEC13 with NUP145C (AA109-179) insertion blade Deposited 2009-09-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–297（297 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；289 K；0.1M Tris, 22% PEG 4000, 0.25 M LiCl, pH 8.3, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.60 Å R-free 0.254
3MZK Sec13/Sec16 complex, S.cerevisiae Deposited 2010-05-12	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–297（297 aa） Chain D 1–297（297 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；0.1mM bis-Tris propane, 0.2M NaBr, 12% polyethylene glycol 3350, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.69 Å R-free 0.243
3MZL Sec13/Sec31 edge element, loop deletion mutant Deposited 2010-05-12	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–297（297 aa） Chain C 1–297（297 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.9；289 K；0.1mM bis-Tris propane, 0.2M sodium citrate, 16% polyethylene glycol 3350, pH 6.9, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.80 Å R-free 0.300
3MZL Sec13/Sec31 edge element, loop deletion mutant Deposited 2010-05-12	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–297（297 aa） Chain G 1–297（297 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.9；289 K；0.1mM bis-Tris propane, 0.2M sodium citrate, 16% polyethylene glycol 3350, pH 6.9, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.80 Å R-free 0.300
4BZJ The structure of the COPII coat assembled on membranes Deposited 2013-07-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 2–292（291 aa） Chain F 2–292（291 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer HEPES, 50 MM KOAC, 1.2 MM MGCL2；pH 6.8；HEPES, 50 MM KOAC, 1.2 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；ETHANE; HOMEMADE PLUNGER	Resolution 40.00 Å
4BZK The structure of the COPII coat assembled on membranes Deposited 2013-07-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–297（297 aa） Chain F 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer HEPES, 50 MM KOAC, 1.2 MM MGCL2；pH 6.8；HEPES, 50 MM KOAC, 1.2 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；ETHANE; HOMEMADE PLUNGER	Resolution 40.00 Å
4XMM Structure of the yeast coat nucleoporin complex, space group C2 Deposited 2015-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–297（297 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；PEG 20000, ethanol, MES	Resolution 7.38 Å R-free 0.353
4XMN Structure of the yeast coat nucleoporin complex, space group P212121 Deposited 2015-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 2–297（296 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；PEG 20000, ethanol, MES	Resolution 7.60 Å R-free 0.347
6ZG5 COPII on membranes, outer coat right-handed rod, class1 Deposited 2020-06-18	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–297（297 aa） Chain F 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 40.00 Å
6ZG6 COPII on membranes, outer coat vertex Deposited 2020-06-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–297（297 aa） Chain D 1–297（297 aa） Chain F 1–297（297 aa） Chain H 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 12.00 Å
6ZL0 COPII on membranes, outer coat left-handed rod Deposited 2020-06-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–297（297 aa） Chain D 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 40.00 Å
7N84 Double nuclear outer ring from the isolated yeast NPC Deposited 2021-06-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 136 PDB declaration: 136-meric	Chain d 1–297（297 aa） Chain o 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.60 Å
7N84 Double nuclear outer ring from the isolated yeast NPC Deposited 2021-06-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain d 1–297（297 aa） Chain o 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.60 Å
7N84 Double nuclear outer ring from the isolated yeast NPC Deposited 2021-06-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain d 1–297（297 aa） Chain o 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.60 Å
7N9F Structure of the in situ yeast NPC Deposited 2021-06-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 448 PDB declaration: 448-meric	Chain d 1–297（297 aa） Chain k 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；A custom-built vitrification device (Max Planck Institute for Biochemistry, Munich)	Resolution 37.00 Å
7N9F Structure of the in situ yeast NPC Deposited 2021-06-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain d 1–297（297 aa） Chain k 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；A custom-built vitrification device (Max Planck Institute for Biochemistry, Munich)	Resolution 37.00 Å
7N9F Structure of the in situ yeast NPC Deposited 2021-06-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain d 1–297（297 aa） Chain k 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；A custom-built vitrification device (Max Planck Institute for Biochemistry, Munich)	Resolution 37.00 Å
8TIE Double nuclear outer ring of Nup84-complexes from the yeast NPC Deposited 2023-07-19	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain d 1–297（297 aa） Chain o 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES,50mM Potassium acetate,20mM NaCl,2mM MgCl2,1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.10 Å
9H5K Cryo-EM structure of the SEAC-EGOC supercomplex Deposited 2024-10-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain H 1–297（297 aa） Chain P 1–297（297 aa）	Not recorded	ZN ZINC ION × 28 MG MAGNESIUM ION × 2 AF3 ALUMINUM FLUORIDE × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

19 other PDB entries and 26 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SEC13_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–297； UniProt 1–297 Author chain P； PDBConstruct 1–297； UniProt 1–297

Restriction of telomere capping protein 1

OrganismNot specified

UniProt Q08281

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 22 PDB declaration: 22-meric（22） Consistent with protein copy count	Chain A； UniProt 1–1341 Chain I； UniProt 1–1341	Not recorded	Maintenance of telomere capping protein 5 × 2 （Q03897） Nucleoporin SEH1 × 6 （P53011） SEH-associated protein 4 × 4 （P38164） Protein transport protein SEC13 × 2 （Q04491） Nitrogen permease regulator 3 × 2 （P38742） Vacuolar membrane-associated protein IML1 × 2 （P47170） Nitrogen permease regulator 2 × 2 （P39923） ZN ZINC ION × 28	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.95 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ADL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9H5K Cryo-EM structure of the SEAC-EGOC supercomplex Deposited 2024-10-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain A 1–1341（1341 aa） Chain I 1–1341（1341 aa）	Not recorded	ZN ZINC ION × 28 MG MAGNESIUM ION × 2 AF3 ALUMINUM FLUORIDE × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RTC1_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–1341； UniProt 1–1341 Author chain I； PDBConstruct 1–1341； UniProt 1–1341

Nitrogen permease regulator 3

OrganismNot specified

UniProt P38742

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 22 PDB declaration: 22-meric（22） Consistent with protein copy count	Chain U； UniProt 1–1146 Chain V； UniProt 1–1146	Not recorded	Maintenance of telomere capping protein 5 × 2 （Q03897） Nucleoporin SEH1 × 6 （P53011） SEH-associated protein 4 × 4 （P38164） Protein transport protein SEC13 × 2 （Q04491） Restriction of telomere capping protein 1 × 2 （Q08281） Vacuolar membrane-associated protein IML1 × 2 （P47170） Nitrogen permease regulator 2 × 2 （P39923） ZN ZINC ION × 28	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.95 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ADL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AE6 Cryo-EM structure of the SEA complex wing (SEACIT) Deposited 2022-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain U 1–1146（1146 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9H4Q Cryo-EM structure of the SEAC wing - EGOC Deposited 2024-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain h 1–1146（1146 aa）	Not recorded	MG MAGNESIUM ION × 1 AF3 ALUMINUM FLUORIDE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9H5K Cryo-EM structure of the SEAC-EGOC supercomplex Deposited 2024-10-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain h 1–1146（1146 aa） Chain i 1–1146（1146 aa）	Not recorded	ZN ZINC ION × 28 MG MAGNESIUM ION × 2 AF3 ALUMINUM FLUORIDE × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NPR3_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain U； PDBConstruct 1–1146； UniProt 1–1146 Author chain V； PDBConstruct 1–1146； UniProt 1–1146

Vacuolar membrane-associated protein IML1

OrganismNot specified

UniProt P47170

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 22 PDB declaration: 22-meric（22） Consistent with protein copy count	Chain W； UniProt 1–1584 Chain X； UniProt 1–1584	Not recorded	Maintenance of telomere capping protein 5 × 2 （Q03897） Nucleoporin SEH1 × 6 （P53011） SEH-associated protein 4 × 4 （P38164） Protein transport protein SEC13 × 2 （Q04491） Restriction of telomere capping protein 1 × 2 （Q08281） Nitrogen permease regulator 3 × 2 （P38742） Nitrogen permease regulator 2 × 2 （P39923） ZN ZINC ION × 28	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.95 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ADL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AE6 Cryo-EM structure of the SEA complex wing (SEACIT) Deposited 2022-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain W 1–1584（1584 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9H4Q Cryo-EM structure of the SEAC wing - EGOC Deposited 2024-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain X 1–1584（1584 aa）	Not recorded	MG MAGNESIUM ION × 1 AF3 ALUMINUM FLUORIDE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9H5K Cryo-EM structure of the SEAC-EGOC supercomplex Deposited 2024-10-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain X 1–1584（1584 aa） Chain j 1–1584（1584 aa）	Not recorded	ZN ZINC ION × 28 MG MAGNESIUM ION × 2 AF3 ALUMINUM FLUORIDE × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IML1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain W； PDBConstruct 1–1584； UniProt 1–1584 Author chain X； PDBConstruct 1–1584； UniProt 1–1584

Nitrogen permease regulator 2

OrganismNot specified

UniProt P39923

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 22 PDB declaration: 22-meric（22） Consistent with protein copy count	Chain S； UniProt 1–615 Chain T； UniProt 1–615	Not recorded	Maintenance of telomere capping protein 5 × 2 （Q03897） Nucleoporin SEH1 × 6 （P53011） SEH-associated protein 4 × 4 （P38164） Protein transport protein SEC13 × 2 （Q04491） Restriction of telomere capping protein 1 × 2 （Q08281） Nitrogen permease regulator 3 × 2 （P38742） Vacuolar membrane-associated protein IML1 × 2 （P47170） ZN ZINC ION × 28	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.95 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ADL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AE6 Cryo-EM structure of the SEA complex wing (SEACIT) Deposited 2022-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain S 1–615（615 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9H4Q Cryo-EM structure of the SEAC wing - EGOC Deposited 2024-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain T 1–615（615 aa）	Not recorded	MG MAGNESIUM ION × 1 AF3 ALUMINUM FLUORIDE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9H5K Cryo-EM structure of the SEAC-EGOC supercomplex Deposited 2024-10-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 32 PDB declaration: 32-meric	Chain T 1–615（615 aa） Chain g 1–615（615 aa）	Not recorded	ZN ZINC ION × 28 MG MAGNESIUM ION × 2 AF3 ALUMINUM FLUORIDE × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NPR2_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain S； PDBConstruct 1–615； UniProt 1–615 Author chain T； PDBConstruct 1–615； UniProt 1–615

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8adl
Deposition date deposition_date	2022-07-08
Structure title title	Cryo-EM structure of the SEA complex
Keywords keywords	GTPase activating protein, coatomer, TOR signaling, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	104.00 Å
Forward intensity I(0) i0	26511500000.00
Molecular weight molecular_weight	1406500.0 kDa
Excluded volume excluded_volume	1764700 Å³
Envelope volume envelope_volume	3315500 Å³
Hydration-shell volume shell_volume	272350 Å³
Envelope diameter envelope_diameter	316.8 Å
Shell Rg shell_rg	96.42 Å
Envelope Rg envelope_rg	97.64 Å
Shape Rg shape_rg	104.00 Å
Total Rg total_rg	103.90 Å
Total atoms total_atoms	98972
Residues n_residues	12238
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	252.3 Å
Rg (real space) rg_real	100.90 Å
Rg uncertainty (real space) rg_real_error	0.59 Å
I(0) (real space) i0_real	2.5530e+10
I(0) uncertainty (real space) i0_real_error	5.0010e+08
Rg (reciprocal space) rg_reciprocal	105.70 Å
I(0) (reciprocal space) i0_reciprocal	26630000000.0000
Solution quality estimate total_estimate	0.9148
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	117.7 Å
Skewness Skewness skewness	-0.005
Kurtosis Kurtosis kurtosis	-0.706
Angular range angular_range	— – 0.0750 Å⁻¹
Current regularization parameter α current_alpha	0.3734
Highest regularization parameter α highest_alpha	564500000.0000
Real-space data points n_real_points	16
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.999; Stabil: 0.966; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Maintenance of telomere capping protein 5
Molecular weight formula_weight	131104.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,Q
Atom count atom_count	98972

MCSSINEGPYNSPTFGKSLSLKVDGGFNAVSINPSGRDIVLASRQGLYIIDLDDPFTPPRWLHHITPWQVADVQWSPHPAKPYWIVSTSNQKAIIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGNDIFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIMSSSNDGTVKFWDYSKSTTESKRTVTTNFPIWRGRYLPFGEGYCIMPMVGGNNAVYLINLCDDDDSEQNKKTKLQPIYAFKGHSDRVIDFLWRSRHTCDGDYDDREFQLVTWSKDCDLKLWPISDSIYGKVNFDRGKRLEEKLPDYDYCSYNKEPENRENVQKNEFRRLRENFVTTSGLKKNKTNHITWLSGIRMNSATSQEDLFNETKIQNLGEEVSAIGHKFPKVVFEKISVSTRELCLTLNGPWSEENPDDYIFLRISINFPLNYPNKGDPPKFTIEENSNLTMSKRQEILSNLATIGQKYTDSNLYCLEPCIRFVLGEKVSLEDIEEGQEPLLNFDIADHIDFEELSSLDSSYSDSQNPENLSSQSDIESYKEALVFPDTSNQGLDFGRNLALDTTPVPNGCGSCWTATGELFCFFANEKKPEKKQNAIIKLSQKEAGVEKHPFKIEPQVLYDKEVDSSVITAADELKARPKRYVDTLGLGGGTNGDSRTYFDDETSSDDSFDSVADDWDDILRNDIIVRTKIPILRGNFKAFSSVHSESGKTVESTKKNKNLVISKNFSSLLSDRKELALEYLFMDATPEGFARNNALVAEKFDLDEISHCWQILSDMLIDQSDYDPYTTIWNNHPMGIKWFIKEAIVYFERQQNLQMLAMLCCVILSARRKKIPARYYGQELENMEGTIVFNDNESQNTSFWKGSDAFSTRSRSSTVTPNFYGNHLRGKNIHGGDNSSIRSDDHHARLRTHNTLNGSSKFTEPAQKQGSRAISSSPFHSRMPDIKVELLHDDIIEAYEQEDLLHLEVSDIPKFQTYIYQYSKLLFRWGLPLERVKILKVSTDFRSSYSSQGIPPNNNKKSPYNGVLTHWIENNEFGEEKFLARNCNYCDLRVTRSSFICGNCQHVLHSSCARIWWEIGDECPSGCGCNCPEMFDA

Entity 2 Entity 2 polymer

Description description	Nucleoporin SEH1
Molecular weight formula_weight	39170.8 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,D,F,M,L,N

MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ

Entity 3 Entity 3 polymer

Description description	SEH-associated protein 4
Molecular weight formula_weight	117775.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,B,O,J

MGLIKKVTHWSYDNLIDYLSVNPTRDEVTHYKVDPENESDESIIKLHTVKDFGSITCLDYSESEIGMIGVGEKNGYLRIFNISGQNSSSPASHAPVGLNANNETSMTNASGGKAAQAENIVGSVSNLKDTQGYPVSETNYDIRVRAKKQRCINSLGINTNGLIAMGLDRNKHDSSLQIWDMNYHDDSHETINPMFSYCTNESIVSLKFLNDTSVLAASTKFLKEIDVRSPNPIYQHPTRLTYDIKLNPFNDWQFSTYGDDGTLAIWDRRKLSDQASLGDLNVASPLLTFEKLVGSGAASRKYMNSCFRWSCVRNNEFATLHRGDTIKRWRLGYYCDSNRDIAADDDNEMNIENLFVSSVHDTNTMYDRVATFDYIPRSNNGTSLICMRQSGTIYRMPISEVCSKAILNNRNSLLLSNFENTEIDEIRVNNEHEKSNLENVKTILKNLSFEDLDVSEDYFPSGHDEPNNEIEYSELSEEENEGSNDVLDSKRGFELFWKPEKLLEKDISVIMRTRASLGYGLDPMNTVEMIDSSKNLQNNAYIRNTWRWIAIAKASVDDGTMVSGDLDLGYEGVIGIWNGINGISNQDRYRQETILSDKQLNKEMEKIIKLRRKNRDRNSPIANAAGSPKYVQRRLCLIISGWDLSRSDYEDKYNIIMKNGHYEKAAAWAVFFGDIPKAVEILGSAKKERLRLIATAIAGYLAYKDLPGNNAWRQQCRKMSSELDDPYLRVIFAFIADNDWWDILYEPAISLRERLGVALRFLNDTDLTTFLDRTSSTVIENGELEGLILTGITPNGIDLLQSYVNKTSDVQSAALISIFGSPRYFRDQRVDEWIQTYRDMLKSWELFSMRARFDVLRSKLSRTKTGVLTADIKPRQIYIQCQNCKQNINTPRTSSPSSAVSTSAGNYKNGEAYRRNNADYKKFNTGSSEAQAADEKPRHKYCCPHCGSSFPRCAICLMPLGTSNLPFVINGTQSRDPMQTEDSQDGANRELVSRKLKLNEWFSFCLSCNHGMHAGHAEEWFDRHNVCPTPGCTCQCNK

Entity 4 Entity 4 polymer

Description description	Protein transport protein SEC13
Molecular weight formula_weight	33083.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,P

MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ

Entity 5 Entity 5 polymer

Description description	Restriction of telomere capping protein 1
Molecular weight formula_weight	149533.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,I

MSLSPHVENASIPKGSTPIPKNRNVSSIGKGEFLGSSSSNNSSFRMNHYSNSGQPSVLDSIRRPNLTPTFSYSNGVYMPESHRTSSFNDSYLPYDKNPYAKTTGSMSNKSNMKIKTKKNAINTNTRKSSGLIYTTKVDKELSSIDKVNDPNINGLVCAGKTHLGLYKFSPSDRSIKCVHDFITPNSNTSTRGTTSLLPKLSKRTRQNKFSTIADVKTGFNNYKNCIAVCNNSTAISIYDLNKSSSIDNPLITSLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWDLRSNKSKSSNRSDISINTASDSIRDVKWMPGYNFASKNDQGSSTYGNLKSGYKFASIHDSGYLLKFDLRQPAQYEKKLNAHTGPGLCLNWHPNQEYIATGGRDGKCCLWFVGDNANAAENTVLNYGNSPSLHAPNTSLNNSGSLAFPKLTINTGYPVTKLKFKPAYSSNIYNSLLGISSMGDEAEVRIYSLARKYIPKHVLLSETPSLGLVWWDENLIFNIDKGTRINGWDINKEPTVLENLSKNTTTWRDLDGNGLLSVDQEIGSYEVVEPELQPTSSTTCKKHPGTIKNPKNGNPENQGIIGGIKKGFSHTGLTSFTPERPPTLKAGPTFSTKSLTLASGASSFNSSSASLTSLTPQTENREEIAIEPPCIITLDIPQIFNNIRLTKIAHSRKKNVISESSSMKNSPVEKFKYLARQLKFSYIREHNVSDSADTAYKNDIENIDVVKNATETHGDNTTTTNNNDDGDDDDDDDDDDKIIESHLLKKYNFPENNTWATLMNEKVNNKKSKRNSSSSREFDEKDVRSSISSISASRQSHDRARKIDKNVEAELQEKIQTLVDLISIATHNASVYLSIDDLTNFKIWILIRDSLLWDLKWMTSSQISSDNASNMDANESSDFEAGENLKTGKEFPEEDGAGTSGAESLVEERPQAFRANSDEPSDAEKKPVSKLKEQLKNTEIIPYAQPNEDSDEVLTKLKELQNQRLESRTKMGETVSDDVIIEEDEHEHQEEEQPHDSPTKSAQFHASPIAKSIPILQKREHRKSFIDTFMLHSPNGYNGDTDIGNEDDNISPRFTYNSVSPRSKVSSLQSYATTTSQLETFKKLSSHTAPIIGSPRHAPSRPDSIGREQLSSSLTKKLAKCKKIIADPPWDTKKLIKQLYNQATETGNVVLTVNILFLFQTIYQITEIDIAKDAIAHFLLLLHRYELFGIAADVLKYCPFEDIMGSEGDQSSIRLFCERCGELITNESSKEKLRAEAQQTGNKKIMDKFGYWYCDSCKKKNTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECPGGCPGVAFI

Entity 6 Entity 6 polymer

Description description	Nitrogen permease regulator 3
Molecular weight formula_weight	130141.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V

MDECLPNSCLLGVHLVISTHSGPQIVYHYPPSNTAFLTNNPTKHQHLYGNHANLNKNTSTNKEEKLFNSGSTKTASQIALNESAKSYNTAITPSMTNTNTNNVTLPPTRSHANTVGSQSSIPAATNGVGYRKTDIEDTSRTFQYQETESETSSSGLSDSELSTDYLDISSDSFSISSSLSSSSLSSSPSSSSSSSPPQDGLSRTNSSFQSTDSMSPTSPQMIMENDSISVAESYLDSGTNNKSRAASKRSQNFFHKLSTKKSTDSKTHSPVRKLKSKPSQSTKKGNKLLKNTSNETDGNAFTGSCSISSKKSLSSTGEHNQELRNSSLNDTPGQSPHHYHHRYHHYHKNAATSQRNSHTQYDVEEEDMEVSAMLQDGKISMNEIFFEEENFQDINKILEFDNDFVAEFCSPEREMCNTRFEFTVDNFCFLGLPIHVDSQGRWRKSKHKNKTRSKRSSSTTTNISRKKSIASKISSLSENTLKKVNSGEADTVYDSNIGHEASTDTPNLRINTDVSGNEFEREKEDLGKNMNMFHVCFVMNPHLIEYNKRIDDMYQFVVTRLSLLLRYVQSKTSYISSECHIILKEKERVLKHSKTYQSIRGAGNKGKYLYQRILAKSSLARALTECVDKIQRNEIACLEINDDKVISLQIPIQNEFEKMPNFKLQPVLRGSYLTSILNMKFLEKSSLRIESQNRQNDQAQFSDTNNNIYRFGNNINSTGHCGAANVDDGDDNESNYYCDDNDDLLNYALLLLDEPNNIISSLETFSYQDDIGTIILKHLVRNIQPNIPLRSYRYLITDLLDNPSSLDDLTTETNSLESSILRSCALHLMYWRHARIVIPLSSKYTYIVSPLAPIQGYTIDDYKSTSQNDGNVKKMDDRENNKSGSDRVPLIYQNSMLFRSKFPSLPSLPIFLSLLSTDKPQAYSNIIPSREHKPVYLNALAWLIQYGYVTQLLTFINIRVDKHIKMAVDEDLEKEGFRKTNTARRPSMDYKKTDKKLDDEDGQSRDANASEACSGKNEGMQSNDNNKDVDEKDNENDSRVDDRDDNEIAIADEEEILHFEYDDPEMQHDYTIILEPERATAIEKRWLYRCIYGQPSDIQILFNKLLKYFNGKVPMELVIIKEEISRHDLKKLLNALDKYLIEIHHW

Entity 7 Entity 7 polymer

Description description	Vacuolar membrane-associated protein IML1
Molecular weight formula_weight	182203.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,X

MFAKLHGKKQRPISSINSQTPRTSNTTHANSISLSSGNLIVGSNRNLRQKKEQFGSQQRASGRKLISNKENDDNVNNGGDNNYDNGERVHRHHIPGLKIKAYQAELGYHESRFSENLVMLNLVEFPDIKPGDLVELKTYHKNPSASNGDKKIYFIAKDFDGETKRRAKTSNVSILSGQLQTLLDLPSRSRIWIKLKPNKFDLQADVVEFNIKDCLLNRGDMWVLSSKLVDTCVFMDQRLAFLDSIRGTIKGIYRNGKKIVSGYIGEQTRIIFRSESARLIFLIQITDEMWNFEETGEQLFQKMVNSFFPKIFKKWKDVDTHHTITIAFAISMDLSDTSFKDLTPGESLKNSQDYFRIVVDQVSIIHWVDIMETLREEFMEIRKDLLNKQTDKGYSVANGRFSPVIKSNFLELVNFATTILTDPFKQLDLRHTTTHVMIISPGSGLFDVDYSLLRLTGKKLLSLEMTMDLICLSKAPLHIVPLFRYRDFENKLHHCVPLWLSVFFWNDHDKKSNSEWTPRCKIYDLQMMGITENELIREVDVEYLQLNKKVKSLSEFMNDYDKNAFEVKILCAGSNTKQSKKLNSKFDTVFENDVVVKARKIPATATTTHGNTKFIWRGPKVALPAIKDIQKPNVIPDLSIKTIEASFYDDCNTTNDKISTPTTSNNDNLEMNDSLVSVRSADNQNTSLALDSLKGLSKRNSLKDFTQRVITKFISNIDTSKNKKIKSTLLRDDVDNSPLGSNTPLPSSESKISGLKLQQKGLADENVISKRGNLIIKKNLSIFGLPSNEIMSGSPSSYLGSSHTRTSSKLSNMSDKAAFITEGQKSKHDDSNTYSLTQQLKHRISETWVDIKSPSIPVSSEFANELLPIRWKDVWPKYVARKYSKWRSFTTPAELPITISDFPSKDDFDRNFIFRNHSVTLNTDQEQYNQTYKDLLRDMIYMRLLTGFQICVGRQVEKIELSRESGESETVVNKYLDFNQNDAFKLYLMIDSEIHRITCSSSGIIDVERYLRKDEANLFDQVPSYIPLVKTRYESSFRDAMIDPLHVKRESLNWNQIDQVLAGYGDNLIDRKWHGFRAKYVVLPTDIPPNTYSMVINGKSETLNPEEIRVEGLRRLIGSITRSRLRTEKEKKGRKTKREEIQPEVMFYTGPLYNFINEQQTSLESSAINFKDSIFVNDNNLLNRNVELSKLAYQIQRGEDRITLVNRKWHWKKHEKCFVGSEMVNWLIRNFSDIDTREDAIKYGQKVMKEGLFVHVLNKHNFLDGHYFYQFSPEYVMDTNKLEKTNSHRSTLSDPKQMLRKASTGSSNDPSAMTPFSSVVPAISASNASVADAKEPSRPILMLSNSLVIDVDPAGKSSKQESCTVHYDRVHNPDHCFHIRLEWLTTTPKLIDDLVGNWSRLCERYGLKMIEIPWEELCTIPSVNPFHSFVEIKLAINPWEDPEFKDRELFAKSKFYYHVYLLKASGFLLDNRASKFLQNQDIEFDIMYSWGKPQFKYVQYIHHTGAYVAELRENGCLFLAPNNIYISRVNPGNIIGKIHSASSSSLDAQKVILNFKSTCLDYQKLRSIFLDAKEMWITGKIVED

Entity 8 Entity 8 polymer

Description description	Nitrogen permease regulator 2
Molecular weight formula_weight	69937.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T

MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSRYSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNLKPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVINS

Entity 9 Entity 9 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	28

▼

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	8adlB01
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	8adlG01
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	8adlJ01
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	8adlO01
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.95 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	208379

fit	/app/data/saxs_computation/ad/8adl/8adl.fit
pddf	/app/data/pr_computation/ad/8adl/8adl.pr.out
profile	/app/data/saxs_computation/ad/8adl/8adl.dat

Cryo-EM structure of the SEA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Maintenance of telomere capping protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Nucleoporin SEH1

State in the Current Structure

Other States of the Same Protein in the Database

SEH-associated protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Protein transport protein SEC13

State in the Current Structure

Other States of the Same Protein in the Database

Restriction of telomere capping protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Nitrogen permease regulator 3

State in the Current Structure

Other States of the Same Protein in the Database

Vacuolar membrane-associated protein IML1

State in the Current Structure

Other States of the Same Protein in the Database

Nitrogen permease regulator 2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 non-polymer

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)