7n84

Double nuclear outer ring from the isolated yeast NPC

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoporin NUP188

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 136	unknown × 16 Nucleoporin NUP120 × 16 （P35729） Nucleoporin NUP85 × 16 （P46673） Nucleoporin 145c × 16 （P49687） Protein transport protein SEC13 × 16 （Q04491） Nucleoporin SEH1 × 16 （P53011） Nucleoporin NUP84 × 16 （P52891） Nucleoporin NUP133 × 16 （P36161）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 17	unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 17	unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU188_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain X； PDBConstruct 1–1655； UniProt 1–1655

Nucleoporin NUP120

OrganismNot specified

UniProt P35729

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 136	Nucleoporin NUP188 × 8 （P52593） unknown × 16 Nucleoporin NUP85 × 16 （P46673） Nucleoporin 145c × 16 （P49687） Protein transport protein SEC13 × 16 （Q04491） Nucleoporin SEH1 × 16 （P53011） Nucleoporin NUP84 × 16 （P52891） Nucleoporin NUP133 × 16 （P36161）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU120_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain a； PDBConstruct 1–1037； UniProt 1–1037 Author chain l； PDBConstruct 1–1037； UniProt 1–1037

Nucleoporin NUP85

OrganismNot specified

UniProt P46673

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 136	Nucleoporin NUP188 × 8 （P52593） unknown × 16 Nucleoporin NUP120 × 16 （P35729） Nucleoporin 145c × 16 （P49687） Protein transport protein SEC13 × 16 （Q04491） Nucleoporin SEH1 × 16 （P53011） Nucleoporin NUP84 × 16 （P52891） Nucleoporin NUP133 × 16 （P36161）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUP85_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain b； PDBConstruct 1–744； UniProt 1–744 Author chain m； PDBConstruct 1–744； UniProt 1–744

Nucleoporin 145c

OrganismNot specified

UniProt P49687

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 136	Nucleoporin NUP188 × 8 （P52593） unknown × 16 Nucleoporin NUP120 × 16 （P35729） Nucleoporin NUP85 × 16 （P46673） Protein transport protein SEC13 × 16 （Q04491） Nucleoporin SEH1 × 16 （P53011） Nucleoporin NUP84 × 16 （P52891） Nucleoporin NUP133 × 16 （P36161）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU145_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain c； PDBConstruct 1–712； UniProt 606–1317 Author chain n； PDBConstruct 1–712； UniProt 606–1317

Protein transport protein SEC13

OrganismNot specified

UniProt Q04491

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 136	Nucleoporin NUP188 × 8 （P52593） unknown × 16 Nucleoporin NUP120 × 16 （P35729） Nucleoporin NUP85 × 16 （P46673） Nucleoporin 145c × 16 （P49687） Nucleoporin SEH1 × 16 （P53011） Nucleoporin NUP84 × 16 （P52891） Nucleoporin NUP133 × 16 （P36161）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SEC13_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain d； PDBConstruct 1–297； UniProt 1–297 Author chain o； PDBConstruct 1–297； UniProt 1–297

Nucleoporin SEH1

OrganismNot specified

UniProt P53011

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 136	Nucleoporin NUP188 × 8 （P52593） unknown × 16 Nucleoporin NUP120 × 16 （P35729） Nucleoporin NUP85 × 16 （P46673） Nucleoporin 145c × 16 （P49687） Protein transport protein SEC13 × 16 （Q04491） Nucleoporin NUP84 × 16 （P52891） Nucleoporin NUP133 × 16 （P36161）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin NUP84 × 2 （P52891） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SEH1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain e； PDBConstruct 1–349； UniProt 1–349 Author chain p； PDBConstruct 1–349； UniProt 1–349

Nucleoporin NUP84

OrganismNot specified

UniProt P52891

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 136	Nucleoporin NUP188 × 8 （P52593） unknown × 16 Nucleoporin NUP120 × 16 （P35729） Nucleoporin NUP85 × 16 （P46673） Nucleoporin 145c × 16 （P49687） Protein transport protein SEC13 × 16 （Q04491） Nucleoporin SEH1 × 16 （P53011） Nucleoporin NUP133 × 16 （P36161）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP133 × 2 （P36161）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUP84_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain f； PDBConstruct 1–726； UniProt 1–726 Author chain q； PDBConstruct 1–726； UniProt 1–726

Nucleoporin NUP133

OrganismNot specified

UniProt P36161

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 136	Nucleoporin NUP188 × 8 （P52593） unknown × 16 Nucleoporin NUP120 × 16 （P35729） Nucleoporin NUP85 × 16 （P46673） Nucleoporin 145c × 16 （P49687） Protein transport protein SEC13 × 16 （Q04491） Nucleoporin SEH1 × 16 （P53011） Nucleoporin NUP84 × 16 （P52891）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 17	Nucleoporin NUP188 × 1 （P52593） unknown × 2 Nucleoporin NUP120 × 2 （P35729） Nucleoporin NUP85 × 2 （P46673） Nucleoporin 145c × 2 （P49687） Protein transport protein SEC13 × 2 （Q04491） Nucleoporin SEH1 × 2 （P53011） Nucleoporin NUP84 × 2 （P52891）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU133_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain g； PDBConstruct 1–1157； UniProt 1–1157 Author chain r； PDBConstruct 1–1157； UniProt 1–1157

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7n84
Deposition date deposition_date	2021-06-13
Structure title title	Double nuclear outer ring from the isolated yeast NPC
Keywords keywords	nuclear pore complex, outer ring, Nup84 complex, TRANSLOCASE; TRANSLOCASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7n84__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7n84__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7n84__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	479.30 Å
Total Rg	479.10 Å
Atom count	665136
Residues	82504
Excluded volume	11920000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7n84__assembly_1__model_1`	136-meric （136）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7n84__assembly_2__model_1`	heptadecameric （17）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`7n84__assembly_3__model_1`	heptadecameric （17）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Nucleoporin NUP188
Molecular weight formula_weight	188753.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X
Atom count atom_count	83142

MATPSFGNSSPQLTFTHVANFMNDAAADVSAVDAKQLAQIRQFLKANKTNLIESLNTIRQNVTSSGDHNKLRSTIANLLQINVDNDPFFAQSEDLSHAVEFFMSERSSRLHIVYSLLVNPDIDLETYSFIDNDRFNVVGKLISIISSVIQNYDIITASSLAHDYNNDQDMFTIVSLVQLKKFSDLKFILQILQILNLMILNTKVPVDIVNQWFLQYQNQFVEFCRNINSTDKSIDTSSLQLYKFQNFQDLSYLSETLISRISSLFTITTILILGLNTSIAQFDIQSPLYMDTETFDTVNSALENDVATNIVNEDPIFHPMIHYSWSFILYYRRALQSSESFDDSDITKFALFAESHDVLQKLNTLSEILSFDPVYTTVITVFLEFSLNFIPITASTSRVFAKIISKAPEQFIENFLTNDTFEKKLSIIKAKLPLLNESLIPLINLALIDTEFANFELKDICSFAVTKSSLNDLDYDLIADTITNSSSSSDIIVPDLIELKSDLLVAPPLENENSNCLLSIPKSTKGKILTIKQQQQQQQQQNGQQPPTTSNLIIFLYKFNGWSLVGRILQNLLHSYMEKGTQLDDLQHELMISIIKLVTNVVDPKTSIEKSSEILSYLSNSLDTSASTINGASIIQVIFEIFEISLQRKDYTSIVQCCEFMTMLTPNYLHLVSSYLNKSDLLDKYGKTGLSNMILGSVELSTGDYTFTIQLLKLTKVFIRESLSLKNIHISKRSKIDIINKLILHAIHIFESYYNWKYNNFLQKFEIAFHLTLIFYDVLHDVFTINPHQKDQLIISSSANKLLQLFLTPMDSIDLAPNTLTNILISPLNTTTKILGDKILGNLYSKVMNNSFKLCTLLIAIRGSNRDLKPSNLEKLLFINSSKLVDVYTLPSYVHFKVQIIELLSYLVEAPWNDDYPFLLSFLGEAKSMAFLKEVLSDLSSPVQDWNLLRSLYIFFTTLLESKQDGLSILFLTGQFASNKKINDESSIDKKSSILTVLQKNSLLLDSTPEEVSCKLLETITYVLNTWTNSKIFIKDPKFVNSLLAKLKDSKKLFQKKENLTRDETVSLIKKYKLISRIVEIFALCIYNSTDSNSEILNFLNQEDLFELVHHFFQIDGFNKTFHDELNLKFKEKWPSLELQSFQKIPLSRINENENFGYDIPLLDIVLKADRSWNEPSKSQTNFKEEITDASLNLQYVNYEISTAKAWGALITTFVKRSTVPLNDGFVDLVEHFLKLNIDFGSDKQMFTQIYLERIELSFYILYSFKLSGKLLKEEKIIELMNKIFTIFKSGEIDFIKNIGKSLKNNFYRPLLRSVLVLLELVSSGDRFIELISDQLLEFFELVFSKGVYLILSEILCQINKCSTRGLSTDHTTQIVNLEDNTQDLLLLLSLFKKITNVNPSKNFNVILASSLNEVGTLKVILNLYSSAHLIRINDEPILGQITLTFISELCSIEPIAAKLINSGLYSVLLESPLSVAIQQGDIKPEFSPRLHNIWSNGLLSIVLLLLSQFGIKVLPETCLFVSYFGKQIKSTIYNWGDNKLAVSSSLIKETNQLVLLQKMLNLLNYQELFIQPKNSDDQQEAVELVIGLDSEHDKKRLSAALSKFLTHPKYLNSRIIPTTLEEQQQLEDESSRLEFVKGISRDIKALQDSLFKDV

Entity 2 Entity 2 polymer

Description description	unknown
Molecular weight formula_weight	5379.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 3 Entity 3 polymer

Description description	Nucleoporin NUP120
Molecular weight formula_weight	120560.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,l

MACLSRIDANLLQYYEKPEPNNTVDLYVSNNSNNNGLKEGDKSISTPVPQPYGSEYSNCLLLSNSEYICYHFSSRSTLLTFYPLSDAYHGKTINIHLPNASMNQRYTLTIQEVEQQLLVNVILKDGSFLTLQLPLSFLFSSANTLNGEWFHLQNPYDFTVRVPHFLFYVSPQFSVVFLEDGGLLGLKKVDGVHYEPLLFNDNSYLKSLTRFFSRSSKSDYDSVISCKLFHERYLIVLTQNCHLKIWDLTSFTLIQDYDMVSQSDSDPSHFRKVEAVGEYLSLYNNTLVTLLPLENGLFQMGTLLVDSSGILTYTFQNNIPTNLSASAIWSIVDLVLTRPLELNVEASYLNLIVLWKSGTASKLQILNVNDESFKNYEWIESVNKSLVDLQSEHDLDIVTKTGDVERGFCNLKSRYGTQIFERAQQILSENKIIMAHNEDEEYLANLETILRDVKTAFNEASSITLYGDEIILVNCFQPYNHSLYKLNTTVENWFYNMHSETDGSELFKYLRTLNGFASTLSNDVLRSISKKFLDIITGELPDSMTTVEKFTDIFKNCLENQFEITNLKILFDELNSFDIPVVLNDLINNQMKPGIFWKKDFISAIKFDGFTSIISLESLHQLLSIHYRITLQVLLTFVLFDLDTEIFGQHISTLLDLHYKQFLLLNLYRQDKCLLAEVLLKDSSEFSFGVKFFNYGQLIAYIDSLNSNVYNASITENSFFMTFFRSYIIENTSHKNIRFFLENVECPFYLRHNEVQEFMFAMTLFSCGNFDQSYEIFQLHDYPEAINDKLPTFLEDLKSENYHGDSIWKDLLCTFTVPYRHSAFYYQLSLLFDRNNSQEFALKCISKSAEYSLKEIQIEELQDFKEKQHIHYLNLLIHFRMFEEVLDVLRLGHECLSDTVRTNFLQLLLQEDIYSRDFFSTLLRLCNAHSDNGELYLRTVDIKIVDSILSQNLRSGDWECFKKLYCFRMLNKSERAAAEVLYQYILMQADLDVIRKRKCYLMVINVLSSFDSAYDQWILNGSKVVTLTDLRDELRGL

Entity 4 Entity 4 polymer

Description description	Nucleoporin NUP85
Molecular weight formula_weight	84972.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,m

MTIDDSNRLLMDVDQFDFLDDGTAQLSNNKTDEEEQLYKRDPVSGAILVPMTVNDQPIEKNGDKMPLKFKLGPLSYQNMAFITAKDKYKLYPVRIPRLDTSKEFSAYVSGLFEIYRDLGDDRVFNVPTIGVVNSNFAKEHNATVNLAMEAILNELEVFIGRVKDQDGRVNRFYELEESLTVLNCLRTMYFILDGQDVEENRSEFIESLLNWINRSDGEPDEEYIEQVFSVKDSTAGKKVFETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDTCAVSFDAVSDSIELLKQYPKDSSSTFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQRKILQYSRTWYESFCGFLLYYIPSLELSAEYLQMSLEANVVDITNDWEQPCVDIISGKIHSILPVMESLDSCTAAFTAMICEAKGLIENIFEGEKNSDDYSNEDNEMLEDLFSYRNGMASYMLNSFAFELCSLGDKELWPVAIGLIALSATGTRSAKKMVIAELLPHYPFVTNDDIEWMLSICVEWRLPEIAKEIYTTLGNQMLSAHNIIESIANFSRAGKYELVKSYSWLLFEASCMEGQKLDDPVLNAIVSKNSPAEDDVIIPQDILDCVVTNSMRQTLAPYAVLSQFYELRDREDWGQALRLLLLLIEFPYLPKHYLVLLVAKFLYPIFLLDDKKLMDEDSVATVIEVIETKWDDADEKSSNLYETIIEADKSLPSSMATLLKNLRKKLNFKLCQAFM

Entity 5 Entity 5 polymer

Description description	Nucleoporin 145c
Molecular weight formula_weight	81157.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,n

SIWGLVNEEDAEIDEDDLSKQEDGGEQPLRKVRTLAQSKPSDKEVILKTDGTFGTLSGKDDSIVEEKAYEPDLSDADFEGIEASPKLDVSKDWVEQLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRFTASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYLDKEIEKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPVSYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQIFLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWSTGGCSIDKNISKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQIDEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANENTEKLYKEVRQRTNALDVQFCWYLIQTLRFNGTRVFSKETSDEATFAFAAQLEFAQLHGHSLFVSCFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALKDRYEGNYLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTLREILNEFPDSERDKWSVSINVFEVYLKLVLDNVETQETIDSLISGMKIFYDQYKHCREVAACCNVMSQEIVSKILEKNNPSIGDSKAKLLELPLGQPEKAYLRGEFAQDLMKCTYKI

Entity 6 Entity 6 polymer

Description description	Protein transport protein SEC13
Molecular weight formula_weight	33083.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,o

MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ

Entity 7 Entity 7 polymer

Description description	Nucleoporin SEH1
Molecular weight formula_weight	39170.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,p

MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ

Entity 8 Entity 8 polymer

Description description	Nucleoporin NUP84
Molecular weight formula_weight	83718.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,q

MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDESNVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIWIVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIFFKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKHSLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIENYLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIHSSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLLKLQGLYENIPIYATFLNESDCLEACSFILSSLEDPQVRKKQIETINFLRLPASNILRRTTQRVFDETEQEYSPSNEISISFDVNNIDMHLIYGVEWLIEGKLYVDAVHSIIALSRRFLLNGRVKALEQFMERNNIGEICKNYELEKIADNISKDENEDQFLEEITQYEHLIKGIREYEEWQKSVSLLSSESNIPTLIEKLQGFSKDTFELIKTFLVDLTSSNFADSADYEILYEIRALYTPFLLMELHKKLVEAAKLLKIPKFISEALAFTSLVANENDKIYLLFQSSGKLKEYLDLVARTATLSN

Entity 9 Entity 9 polymer

Description description	Nucleoporin NUP133
Molecular weight formula_weight	133452.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,r

MSEKKVHLRLRKELSVPIAVVENESLAQLSYEEESQASLMDISMEQQQLRLHSHFDNSKVFTENNRYIVKTLQTDYSSGFSNDDELNGYIDMQIGYGLVNDHKKVYIWNIHSTQKDTPYITVPFRSDDNDEIAVAPRCILTFPATMDESPLALNPNDQDETGGLIIIKGSKAIYYEDINSINNLNFKLSEKFSHELELPINSSGGEKCDLMLNCEPAGIVLSTNMGRIFFITIRNSMGKPQLKLGKLLNKPFKLGIWSKIFNTNSSVVSLRNGPILGKGTRLVYITTNKGIFQTWQLSATNSHPTKLIDVNIYEAILESLQDLYPFAHGTLKIWDSHPLQDESSQLFLSSIYDSSCNETYYILSTIIFDSSSNSFTIFSTYRLNTFMESITDTKFKPKIFIPQMENANDTNEVTSILVMFPNAVVITQVNSKLDSSYSMRRKWEDIVSLRNDIDIIGSGYDSKSLYVLTKQMGVLQFFVKENEETNSKPEVGFVKSHVDQAVYFSKINANPIDFNLPPEISLDQESIEHDLKLTSEEIFHSNGKYIPPMLNTLGQHLSVRKEFFQNFLTFVAKNFNYKISPELKLDLIEKFEILNCCIKFNSIIRQSDVLNDIWEKTLSNYNLTQNEHLTTKTVVINSPDVFPVIFKQFLNHVVFVLFPSQNQNFKLNVTNLINLCFYDGILEEGEKTIRYELLELDPMEVDTSKLPWFINFDYLNCINQCFFDFTFACEEEGSLDSYKEGLLKIVKILYYQFNQFKIWINTQPVKSVNANDNFININNLYDDNHLDWNHVLCKVNLKEQCIQIAEFYKDLSGLVQTLQTLDQNDSTTVSLYETFFNEFPKEFSFTLFEYLIKHKKLNDLIFRFPQQHDVLIQFFQESAPKYGHVAWIQQILDGSYADAMNTLKNITVDDSKKGESLSECELHLNVAKLSSLLVEKDNLDINTLRKIQYNLDTIDAEKNISNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVVNLSDLVELYSMLDDEESLFIPLRLLSVDGNLLNFEVKKFLNALVWRRIVLLNASNEGDKLLQHIVKRVFDEELPKNNDFPLPSVDLLCDKSLLTPEYISETYGRFPIDQNAIREEIYEEISQVETLNSDNSLEIKLHSTIGSVAKEKNYTINYETNTVEY

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	11.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	45000

Double nuclear outer ring from the isolated yeast NPC

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoporin NUP188

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoporin NUP120

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoporin NUP85

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoporin 145c

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein transport protein SEC13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoporin SEH1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoporin NUP84

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoporin NUP133

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7n84__assembly_1__model_1

7n84__assembly_1__model_1 | I(q)

7n84__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer