SAXSdb — 8at2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HAUS augmin-like complex subunit 1

Xenopus laevis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q3B8L5_XENLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–286； UniProt 2–287

HAUS augmin-like complex subunit 3

Xenopus laevis

UniProt Q6DCY9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HAUS3_XENLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–597； UniProt 1–597

HAUS augmin like complex subunit 4 L homeolog

Xenopus laevis

UniProt Q4V7I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4V7I1_XENLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–353； UniProt 1–353

HAUS augmin-like complex subunit 5

Xenopus laevis

UniProt A0A1L8FPI2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1L8FPI2_XENLA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–666； UniProt 1–666

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8at2
Deposition date deposition_date	2022-08-22
Structure title title	Structure of the augmin TIII subcomplex
Keywords keywords	Microtubule, Branching, Nucleation, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8at2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8at2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8at2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	75.17 Å
Rg (electron density)	77.82 Å
Total Rg	76.62 Å
Atom count	11362
Residues	1404
Excluded volume	202370 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8at2__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	HAUS augmin-like complex subunit 1
Molecular weight formula_weight	32684.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	11362

MDEKSTKIIMWLKKMFGDKPLPPYEVNTRTMEILYQLAEWNEARDKDLSLVTEDLKLKSAEVKAEAKYLQDLLTEGLGPSYTNLSRMGNNYLNQIVDSCLALELKNSSLSSYIPAVNDLSSELVAIELNNQEMEAELTSLRKKLTEALVLEKSLERDLKKAEEQCNFEKAKVEIRSQNMKKLKDKSEEYKYKIHAAKDQLSSAGMEEPLTHRSLVSLSETLTELKAQSMAAKEKLNSYLDLAPNPSLVKVKIEEAKRELKATEVELTTKVNMMEFVVPEPSKRRLK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 2 Entity 2 polymer

Description description	HAUS augmin-like complex subunit 3
Molecular weight formula_weight	68112.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSGGDRFVQTLQKLNYPKGAQLDGEDFDWLFEAVDLKPFLDWFCSAASEQNVVPDEKLQAFNTLKESGKPVLDEKALDEVLKTFSISKVPAIEEVAIEKLEEEVKALQKQKNLHIRRRNKLQMVESGNRQMCLKSKDKEEETGRAFQEVLHLLRVTNKKLNHELQSIVNGVQTLMSFFSTPETACELSSQPIFLSQLLLDKYLSLEEQSTAALTSFTKEHFFEGMSKFVEGSDENFQLVQLNVNSFGEDGTTEDKCKEMMRLQLAYICAKHKLIQMKAKSASLKVGLQWAENNASVVQDKASQKEENLKVRITSLKNETLQIENHTNSISNEKLPGLVRDNAQLLNMPIVKGDYDLQMAHQTSCSSRQDLVCDHLMKQKASFELLQLGYELELRKHRDVYRELGSIVQELKESGDKLEERLTMLSDVNLLSASKPRSNIDSKDLTSHRLYQLLDGDNTQKLFRTYDGLESVAQKLSQDIASMRDQLEVSEQEHSLLLSKLDSHLKELRDFMYPEGNTLMLTTPELSGEFHQLGSQLEKLNHITVEILGDLQLKRKMLESNKLQQIEKQLYVYFFQNEEQLKSIVGKLEAQTGGGSSA

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 3 Entity 3 polymer

Description description	HAUS augmin like complex subunit 4 L homeolog
Molecular weight formula_weight	41256.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAQTLQYVSSRLSMLQIDEEDLERNAQFGKVLIELCPLLGPNGGSANLNRELEETRRELLLQRKMWMRSEVIYQLVQEMLLDLQVRKLEGSLTEEERKFQDGLQQCMLVSECSRLLTADSVPPSDSTSILGLDKQDLLDLLPPNMLVLWVRDRLQKQLEEALKKKCFTFLSFHQPETDEEGDVLRAAKVLRLASTLEDEKRRLQNEQEKHQEMRALLEKQQEIYPHVLLRCLSLLRQAASELRLRAQSDIDRINAEYLEAKSNALFLKLRMEELQVLTDCYTPEKVLVHRQIRDTLEAGVKKEKQELSTSRQILSSYEFLGPEFEGLVQEYTRLKDKIKDNRWMLQELSKSLP

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 4 Entity 4 polymer

Description description	HAUS augmin-like complex subunit 5
Molecular weight formula_weight	77357.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MERRSLAQELKKWAVEEMGLPAQKAPSEEMLQRLFIGQCGDIWKFIIRHIHSHRTVRKIEGNLLWYQQLQHTEAQRTAEEEQQQRRKQLCKEILELRAELHHLQEQIQTAEREIVGQDLNCERAQDLCRRSLLLRAFNKKREEECEALCQSNKKIQYRCEQLQEIRRASQREVMFSAVDPDLSSSTFLEPEVLRDVREVCKLRFKFLRSLHDDSISSSVHPGKEDLRSLSHQQWMSMAEKVWNTHTPNHILAALERLTLNSTQELKKLQFSQAADLSKGPSCQLKEFSEPITQSRSCNESTHLDPQETLPSFHSLIQEGWANSVKVSSELRRVQSQAQALSEHLAERIQEIHKKLSDGSEVSVLTRAAFDAELRCVILRGCRDALMQECRMLQEEAAGKKQEMKLLQQQQQNIQEACLLLDKKQKHIQILIKGNSSSKSQIRRSSVEAQKYVQDKLLPWPQEIIQESQRLQDSIQKEVKHFSAICLPALLKVSTDGFNLLPSRELSINRMSNTHAPYYGIFKGIYESVRLPLYKAPESVLSHVADMKKQLFFLRSQLSSRSEAISKTQRALQKNTNPDTDALLKSLSDHYSLELDEMVPKMQRLIQQCEKHQEYGKEVQATVMDWWEQPVQLCLPSEERGGLTLRQWRERWTVAVTALQRATGSRS

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	7.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	82776

Structure of the augmin TIII subcomplex

1. Protein Identity and Related Structures Protein Identity & Related Structures

HAUS augmin-like complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin-like complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin like complex subunit 4 L homeolog

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin-like complex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8at2__assembly_1__model_1

8at2__assembly_1__model_1 | I(q)

8at2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Structure of the augmin TIII subcomplex

1. Protein Identity and Related Structures Protein Identity & Related Structures

HAUS augmin-like complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin-like complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin like complex subunit 4 L homeolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin-like complex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8at2__assembly_1__model_1

8at2__assembly_1__model_1 | I(q)

8at2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)