SAXSdb — 8at3

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HAUS augmin-like complex subunit 1

Xenopus laevis

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain A； UniProt 2–287	Not recorded	HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5	Resolution 33.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8AT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AT2 Structure of the augmin TIII subcomplex Deposited 2022-08-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 2–287（286 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8AT4 Structure of the augmin holocomplex in closed conformation Deposited 2022-08-22	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 2–287（286 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5	Resolution 33.00 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q3B8L5_XENLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–286； UniProt 2–287

HAUS augmin-like complex subunit 3

Xenopus laevis

UniProt Q6DCY9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain B； UniProt 1–597	Not recorded	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5	Resolution 33.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8AT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AT2 Structure of the augmin TIII subcomplex Deposited 2022-08-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–597（597 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8AT4 Structure of the augmin holocomplex in closed conformation Deposited 2022-08-22	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–597（597 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5	Resolution 33.00 Å
8FCK Structure of the vertebrate augmin complex Deposited 2022-12-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–597（597 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.88 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HAUS3_XENLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–597； UniProt 1–597

HAUS augmin like complex subunit 4 L homeolog

Xenopus laevis

UniProt Q4V7I1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain C； UniProt 1–353	Not recorded	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5	Resolution 33.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8AT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AT2 Structure of the augmin TIII subcomplex Deposited 2022-08-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–353（353 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8AT4 Structure of the augmin holocomplex in closed conformation Deposited 2022-08-22	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–353（353 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5	Resolution 33.00 Å
8FCK Structure of the vertebrate augmin complex Deposited 2022-12-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–353（353 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.88 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q4V7I1_XENLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–353； UniProt 1–353

HAUS augmin-like complex subunit 5

Xenopus laevis

UniProt A0A1L8FPI2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain D； UniProt 1–666	Not recorded	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5	Resolution 33.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8AT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AT2 Structure of the augmin TIII subcomplex Deposited 2022-08-22	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–666（666 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
8AT4 Structure of the augmin holocomplex in closed conformation Deposited 2022-08-22	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain D 1–666（666 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5	Resolution 33.00 Å
8FCK Structure of the vertebrate augmin complex Deposited 2022-12-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain D 1–666（666 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.88 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A1L8FPI2_XENLA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–666； UniProt 1–666

HAUS augmin like complex subunit 2 L homeolog

Xenopus laevis

UniProt Q6INL9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain E； UniProt 1–222	Not recorded	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5	Resolution 33.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8AT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AT4 Structure of the augmin holocomplex in closed conformation Deposited 2022-08-22	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–222（222 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5	Resolution 33.00 Å
8FCK Structure of the vertebrate augmin complex Deposited 2022-12-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–222（222 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.88 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q6INL9_XENLA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–222； UniProt 1–222

HAUS augmin like complex subunit 6 L homeolog

Xenopus laevis

UniProt A0JPI0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain F； UniProt 1–978	Not recorded	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5	Resolution 33.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8AT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AT4 Structure of the augmin holocomplex in closed conformation Deposited 2022-08-22	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain F 1–978（978 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5	Resolution 33.00 Å
8FCK Structure of the vertebrate augmin complex Deposited 2022-12-01	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain F 1–430（430 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.88 Å
9OLH Symmetry-expanded reconstruction of augmin T-II bonsai on the GTPgammaS microtubule Deposited 2025-05-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–268（268 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.83 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0JPI0_XENLA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–978； UniProt 1–978

HAUS augmin like complex subunit 7 S homeolog

Xenopus laevis

UniProt B1H1T5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain G； UniProt 1–348	Not recorded	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5	Resolution 33.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8AT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AT4 Structure of the augmin holocomplex in closed conformation Deposited 2022-08-22	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain G 1–348（348 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5	Resolution 33.00 Å
8FCK Structure of the vertebrate augmin complex Deposited 2022-12-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain G 1–348（348 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.88 Å
9D2B Symmetry-expanded reconstruction of augmin T-II bonsai on the microtubule Deposited 2024-08-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 2–261（260 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 3 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.08 Å
9OLH Symmetry-expanded reconstruction of augmin T-II bonsai on the GTPgammaS microtubule Deposited 2025-05-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 2–261（260 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.83 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	B1H1T5_XENLA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–348； UniProt 1–348

HAUS augmin-like complex subunit 8

Xenopus laevis

UniProt Q0IHJ3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain H； UniProt 1–367	Not recorded	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5	Resolution 33.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8AT3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8AT4 Structure of the augmin holocomplex in closed conformation Deposited 2022-08-22	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain H 1–367（367 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5	Resolution 33.00 Å
8FCK Structure of the vertebrate augmin complex Deposited 2022-12-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain H 1–367（367 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.88 Å
9D2B Symmetry-expanded reconstruction of augmin T-II bonsai on the microtubule Deposited 2024-08-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain H 1–257（257 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 3 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.08 Å
9OLH Symmetry-expanded reconstruction of augmin T-II bonsai on the GTPgammaS microtubule Deposited 2025-05-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain H 1–257（257 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.83 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HAUS8_XENLA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–367； UniProt 1–367

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8at3
Deposition date deposition_date	2022-08-22
Structure title title	Structure of the augmin holocomplex in open conformation
Keywords keywords	Microtubule, Branching, Nucleation, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	130.10 Å
Forward intensity I(0) i0	1723790000.00
Molecular weight molecular_weight	350800.0 kDa
Excluded volume excluded_volume	438720 Å³
Envelope volume envelope_volume	1196900 Å³
Hydration-shell volume shell_volume	85417 Å³
Envelope diameter envelope_diameter	459.4 Å
Shell Rg shell_rg	86.43 Å
Envelope Rg envelope_rg	128.50 Å
Shape Rg shape_rg	130.10 Å
Total Rg total_rg	129.60 Å
Total atoms total_atoms	24599
Residues n_residues	3048
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	258.8 Å
Rg (real space) rg_real	95.07 Å
Rg uncertainty (real space) rg_real_error	1.08 Å
I(0) (real space) i0_real	1.4150e+09
I(0) uncertainty (real space) i0_real_error	3.1970e+07
Rg (reciprocal space) rg_reciprocal	100.50 Å
I(0) (reciprocal space) i0_reciprocal	1583000000.0000
Solution quality estimate total_estimate	0.7595
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	129.4 Å
Skewness Skewness skewness	0.148
Kurtosis Kurtosis kurtosis	-1.013
Angular range angular_range	— – 0.0600 Å⁻¹
Current regularization parameter α current_alpha	1.5420
Highest regularization parameter α highest_alpha	56380000.0000
Real-space data points n_real_points	13
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.109; Oscil: 0.863; Stabil: 0.828; Sysdev: 1.000; Positv: 1.000; Valcen: 0.800; Smooth: 0.001

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	HAUS augmin-like complex subunit 1
Molecular weight formula_weight	32684.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	24599

MDEKSTKIIMWLKKMFGDKPLPPYEVNTRTMEILYQLAEWNEARDKDLSLVTEDLKLKSAEVKAEAKYLQDLLTEGLGPSYTNLSRMGNNYLNQIVDSCLALELKNSSLSSYIPAVNDLSSELVAIELNNQEMEAELTSLRKKLTEALVLEKSLERDLKKAEEQCNFEKAKVEIRSQNMKKLKDKSEEYKYKIHAAKDQLSSAGMEEPLTHRSLVSLSETLTELKAQSMAAKEKLNSYLDLAPNPSLVKVKIEEAKRELKATEVELTTKVNMMEFVVPEPSKRRLK

来源 Source

来源生物 organism	Xenopus laevis
通用名 common_name	African clawed frog
NCBI Class编号 ncbi_taxonomy_id	8355
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 2 Entity 2 polymer

Description description	HAUS augmin-like complex subunit 3
Molecular weight formula_weight	68112.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSGGDRFVQTLQKLNYPKGAQLDGEDFDWLFEAVDLKPFLDWFCSAASEQNVVPDEKLQAFNTLKESGKPVLDEKALDEVLKTFSISKVPAIEEVAIEKLEEEVKALQKQKNLHIRRRNKLQMVESGNRQMCLKSKDKEEETGRAFQEVLHLLRVTNKKLNHELQSIVNGVQTLMSFFSTPETACELSSQPIFLSQLLLDKYLSLEEQSTAALTSFTKEHFFEGMSKFVEGSDENFQLVQLNVNSFGEDGTTEDKCKEMMRLQLAYICAKHKLIQMKAKSASLKVGLQWAENNASVVQDKASQKEENLKVRITSLKNETLQIENHTNSISNEKLPGLVRDNAQLLNMPIVKGDYDLQMAHQTSCSSRQDLVCDHLMKQKASFELLQLGYELELRKHRDVYRELGSIVQELKESGDKLEERLTMLSDVNLLSASKPRSNIDSKDLTSHRLYQLLDGDNTQKLFRTYDGLESVAQKLSQDIASMRDQLEVSEQEHSLLLSKLDSHLKELRDFMYPEGNTLMLTTPELSGEFHQLGSQLEKLNHITVEILGDLQLKRKMLESNKLQQIEKQLYVYFFQNEEQLKSIVGKLEAQTGGGSSA

来源 Source

来源生物 organism	Xenopus laevis
通用名 common_name	African clawed frog
NCBI Class编号 ncbi_taxonomy_id	8355
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 3 Entity 3 polymer

Description description	HAUS augmin like complex subunit 4 L homeolog
Molecular weight formula_weight	41256.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAQTLQYVSSRLSMLQIDEEDLERNAQFGKVLIELCPLLGPNGGSANLNRELEETRRELLLQRKMWMRSEVIYQLVQEMLLDLQVRKLEGSLTEEERKFQDGLQQCMLVSECSRLLTADSVPPSDSTSILGLDKQDLLDLLPPNMLVLWVRDRLQKQLEEALKKKCFTFLSFHQPETDEEGDVLRAAKVLRLASTLEDEKRRLQNEQEKHQEMRALLEKQQEIYPHVLLRCLSLLRQAASELRLRAQSDIDRINAEYLEAKSNALFLKLRMEELQVLTDCYTPEKVLVHRQIRDTLEAGVKKEKQELSTSRQILSSYEFLGPEFEGLVQEYTRLKDKIKDNRWMLQELSKSLP

来源 Source

来源生物 organism	Xenopus laevis
通用名 common_name	African clawed frog
NCBI Class编号 ncbi_taxonomy_id	8355
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 4 Entity 4 polymer

Description description	HAUS augmin-like complex subunit 5
Molecular weight formula_weight	77357.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MERRSLAQELKKWAVEEMGLPAQKAPSEEMLQRLFIGQCGDIWKFIIRHIHSHRTVRKIEGNLLWYQQLQHTEAQRTAEEEQQQRRKQLCKEILELRAELHHLQEQIQTAEREIVGQDLNCERAQDLCRRSLLLRAFNKKREEECEALCQSNKKIQYRCEQLQEIRRASQREVMFSAVDPDLSSSTFLEPEVLRDVREVCKLRFKFLRSLHDDSISSSVHPGKEDLRSLSHQQWMSMAEKVWNTHTPNHILAALERLTLNSTQELKKLQFSQAADLSKGPSCQLKEFSEPITQSRSCNESTHLDPQETLPSFHSLIQEGWANSVKVSSELRRVQSQAQALSEHLAERIQEIHKKLSDGSEVSVLTRAAFDAELRCVILRGCRDALMQECRMLQEEAAGKKQEMKLLQQQQQNIQEACLLLDKKQKHIQILIKGNSSSKSQIRRSSVEAQKYVQDKLLPWPQEIIQESQRLQDSIQKEVKHFSAICLPALLKVSTDGFNLLPSRELSINRMSNTHAPYYGIFKGIYESVRLPLYKAPESVLSHVADMKKQLFFLRSQLSSRSEAISKTQRALQKNTNPDTDALLKSLSDHYSLELDEMVPKMQRLIQQCEKHQEYGKEVQATVMDWWEQPVQLCLPSEERGGLTLRQWRERWTVAVTALQRATGSRS

来源 Source

来源生物 organism	Xenopus laevis
通用名 common_name	African clawed frog
NCBI Class编号 ncbi_taxonomy_id	8355
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 5 Entity 5 polymer

Description description	HAUS augmin like complex subunit 2 L homeolog
Molecular weight formula_weight	25135.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MMAANPWSPVQPSAASLLLEKCLAAGVLSQNALDQAQLEAPCFSHAEELQRITEIKAEINQKSLELELLRLEKETADITHPLYLGQKHQALQAMNSHLEAVLREKRSLRQRLAQPVCQENLPIEASYHRFTAELLPLAVNFIEKLEIYIKTIQTIPKIPDCASNMDNALMRMESLEAEMEEVTEQILTWREQQKTAFQMNSDANSSCITAQTSYLSIENLHP

来源 Source

来源生物 organism	Xenopus laevis
通用名 common_name	African clawed frog
NCBI Class编号 ncbi_taxonomy_id	8355
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 6 Entity 6 polymer

Description description	HAUS augmin like complex subunit 6 L homeolog
Molecular weight formula_weight	110863.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MQSGSRPHLAWQREHMWLALQGLGFESGAEAANAGKTLVHVTFGVNMFDKPNKDAFYVVFHFLFGKLDNVRCKEVFRYCWPPLDKKRDAEFRKACCEWLKKISDEVGAGFPQVVASIFLSPGGPKFVHLLYHFARYVMLQHIKRDADAGNVFISEALQSKIQDPQKALARNKLARQKYLKVLQKENLVIEEYQRKAQLLIKQIRDMRSEHVALQNQQKLAEKVDRKISDKDENIQKTRCMWNTIMQMLKEMEKEVDVVDAVVRGNIDQYCLDGTNATLNIPNLLISRIESEMHRLQMDNVYEAGKVNLITVVQLLNEALKLVSGERSLYDCKGVRLDLQYLHGKAKFESEVLTRLRNMRHKIKREDLVSIEKIIADREREWERKWEKILGKCPFSLLKGLNPALELNPPMAPFSFDPASEEVLKSSVFCHYPASLQEYSHKEKPLKDFNQDHSGELVQRLIGATVLTRSGRKSTSSLGMATPNRRRMSLNEREFQTPTMNDRIGFQRTPSSAVQKRRADVSWKTAANSPLPCTPTPYKQDPKNMARQQLAQQVADYIVSESPRSSGGRGMELDDLLGVLSSDPFLSRKEIPRTPENLISDIRSSWRKAIQSEESLVVASPVAAPCMDSTAELESAHCSQIDLSMACFLSTSHASDQNDCSGTRIPHNTGGNKASSLHSDVVHHESIDMKSEIDSSQPEDLSLPIKENEPADKLINLLDDKKESENADTLTNPVEFIFSNQPISKLMDKTMFISVSGQENLSAHTTLSWNSSNMITSDSSSDTHEIIQFGILHETLPENAGNVSLNSTLSLGGNEEPFEKSELSDHDFTFDRKEHSSRSMEGKMDINSIRSRYEALKRTLTSLTDEEYHGDPDTSNMRFTKHKSESSLILGSDVYSPVEKVLSLDLEYLTTPSPKDRKLSLPQLISFSPETIRSEKQEDLLDVFESQDFVNPNKTFDFTSSGLDLQKSTDEGPEQLIKL

来源 Source

来源生物 organism	Xenopus laevis
通用名 common_name	African clawed frog
NCBI Class编号 ncbi_taxonomy_id	8355
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 7 Entity 7 polymer

Description description	HAUS augmin like complex subunit 7 S homeolog
Molecular weight formula_weight	39379.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTGGKELGAAVELYERLQMLSCPCLEGVYLTDPQSIYELLCTPSSHRLDILQWLCSRIYPPVQEQLSSLKESQTDTKVKEIAKLCFDLMLCHFDDLDLIRGHASPFKQISFIGQLLDVIQYPDTISSNVILESLSHSTEKNVVTCIRENEELLKELFSSPHFQATLSPECNPWPADFKPLLNAEESLQKRATQSSKGKDMSNSVEALLEISSSLKALKEECVDLCSSVTDGDKVIQSLRLALTDFHQLTIAFNQIYANEFQEHCGHPAPHMSPMGPFFQFVHQSLSTCFKELESIAQFTETSENIVDVVRERHQSKEKWAGSTISTLCEKMKELRQSYEAFQQSSLQD

来源 Source

来源生物 organism	Xenopus laevis
通用名 common_name	African clawed frog
NCBI Class编号 ncbi_taxonomy_id	8355
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 8 Entity 8 polymer

Description description	HAUS augmin-like complex subunit 8
Molecular weight formula_weight	41144.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSEAGVAPIEDGSQNSSGGSSGDAALKKSKGGAKVVKSRYMQIGRSKVSKNSLANTTVCSGGKVPERGSGGTPTRRSLAPHKAKITAAVPLPALDGSIFTKEDLQSTLLDGHRIARPDLDLSVINDRTLQKITPRPVVTSEQKKPKRDTTPVNLVPEDMVEMIESQTLLLTYLTIKMQKNLFRLEEKAERNLLLVNDQKDQLQETIHMMKRDLTLLQREERLRDLIEKQDEVLTPVVTSKDPFKDNYTTFATALDSTRHQLAIKNIHITGNRHRYLEELQKHLAITKSLLEEIMPSHASENAESFDTIKDLENIVLKTDEELARSFRQILDLSFKVNKEISLQSQKAVEETCESALVRQWYFDGSLP

来源 Source

来源生物 organism	Xenopus laevis
通用名 common_name	African clawed frog
NCBI Class编号 ncbi_taxonomy_id	8355
宿主生物 host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

▶

8. Citations (1)

▶

Resolution resolution	33.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	11969

fit	/app/data/saxs_computation/at/8at3/8at3.fit
pddf	/app/data/pr_computation/at/8at3/8at3.pr.out
profile	/app/data/saxs_computation/at/8at3/8at3.dat

Structure of the augmin holocomplex in open conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

HAUS augmin-like complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin-like complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin like complex subunit 4 L homeolog

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin-like complex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin like complex subunit 2 L homeolog

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin like complex subunit 6 L homeolog

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin like complex subunit 7 S homeolog

State in the Current Structure

Other States of the Same Protein in the Database

HAUS augmin-like complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

来源 Source

Entity 7 Entity 7 polymer

Polymer Polymer

来源 Source

Entity 8 Entity 8 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)