8at3

Structure of the augmin holocomplex in open conformation

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HAUS augmin-like complex subunit 1

Xenopus laevis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q3B8L5_XENLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–286； UniProt 2–287

HAUS augmin-like complex subunit 3

Xenopus laevis

UniProt Q6DCY9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HAUS3_XENLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–597； UniProt 1–597

HAUS augmin like complex subunit 4 L homeolog

Xenopus laevis

UniProt Q4V7I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4V7I1_XENLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–353； UniProt 1–353

HAUS augmin-like complex subunit 5

Xenopus laevis

UniProt A0A1L8FPI2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1L8FPI2_XENLA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–666； UniProt 1–666

HAUS augmin like complex subunit 2 L homeolog

Xenopus laevis

UniProt Q6INL9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6INL9_XENLA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–222； UniProt 1–222

HAUS augmin like complex subunit 6 L homeolog

Xenopus laevis

UniProt A0JPI0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0JPI0_XENLA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–978； UniProt 1–978

HAUS augmin like complex subunit 7 S homeolog

Xenopus laevis

UniProt B1H1T5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin-like complex subunit 8 × 1 （Q0IHJ3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B1H1T5_XENLA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–348； UniProt 1–348

HAUS augmin-like complex subunit 8

Xenopus laevis

UniProt Q0IHJ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HAUS augmin-like complex subunit 1 × 1 （Q3B8L5） HAUS augmin-like complex subunit 3 × 1 （Q6DCY9） HAUS augmin like complex subunit 4 L homeolog × 1 （Q4V7I1） HAUS augmin-like complex subunit 5 × 1 （A0A1L8FPI2） HAUS augmin like complex subunit 2 L homeolog × 1 （Q6INL9） HAUS augmin like complex subunit 6 L homeolog × 1 （A0JPI0） HAUS augmin like complex subunit 7 S homeolog × 1 （B1H1T5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HAUS8_XENLA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–367； UniProt 1–367

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8at3
Deposition date deposition_date	2022-08-22
Structure title title	Structure of the augmin holocomplex in open conformation
Keywords keywords	Microtubule, Branching, Nucleation, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8at3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8at3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8at3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	130.10 Å
Total Rg	129.60 Å
Atom count	24599
Residues	3048
Excluded volume	438720 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8at3__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	HAUS augmin-like complex subunit 1
Molecular weight formula_weight	32684.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	24599

MDEKSTKIIMWLKKMFGDKPLPPYEVNTRTMEILYQLAEWNEARDKDLSLVTEDLKLKSAEVKAEAKYLQDLLTEGLGPSYTNLSRMGNNYLNQIVDSCLALELKNSSLSSYIPAVNDLSSELVAIELNNQEMEAELTSLRKKLTEALVLEKSLERDLKKAEEQCNFEKAKVEIRSQNMKKLKDKSEEYKYKIHAAKDQLSSAGMEEPLTHRSLVSLSETLTELKAQSMAAKEKLNSYLDLAPNPSLVKVKIEEAKRELKATEVELTTKVNMMEFVVPEPSKRRLK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 2 Entity 2 polymer

Description description	HAUS augmin-like complex subunit 3
Molecular weight formula_weight	68112.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSGGDRFVQTLQKLNYPKGAQLDGEDFDWLFEAVDLKPFLDWFCSAASEQNVVPDEKLQAFNTLKESGKPVLDEKALDEVLKTFSISKVPAIEEVAIEKLEEEVKALQKQKNLHIRRRNKLQMVESGNRQMCLKSKDKEEETGRAFQEVLHLLRVTNKKLNHELQSIVNGVQTLMSFFSTPETACELSSQPIFLSQLLLDKYLSLEEQSTAALTSFTKEHFFEGMSKFVEGSDENFQLVQLNVNSFGEDGTTEDKCKEMMRLQLAYICAKHKLIQMKAKSASLKVGLQWAENNASVVQDKASQKEENLKVRITSLKNETLQIENHTNSISNEKLPGLVRDNAQLLNMPIVKGDYDLQMAHQTSCSSRQDLVCDHLMKQKASFELLQLGYELELRKHRDVYRELGSIVQELKESGDKLEERLTMLSDVNLLSASKPRSNIDSKDLTSHRLYQLLDGDNTQKLFRTYDGLESVAQKLSQDIASMRDQLEVSEQEHSLLLSKLDSHLKELRDFMYPEGNTLMLTTPELSGEFHQLGSQLEKLNHITVEILGDLQLKRKMLESNKLQQIEKQLYVYFFQNEEQLKSIVGKLEAQTGGGSSA

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 3 Entity 3 polymer

Description description	HAUS augmin like complex subunit 4 L homeolog
Molecular weight formula_weight	41256.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAQTLQYVSSRLSMLQIDEEDLERNAQFGKVLIELCPLLGPNGGSANLNRELEETRRELLLQRKMWMRSEVIYQLVQEMLLDLQVRKLEGSLTEEERKFQDGLQQCMLVSECSRLLTADSVPPSDSTSILGLDKQDLLDLLPPNMLVLWVRDRLQKQLEEALKKKCFTFLSFHQPETDEEGDVLRAAKVLRLASTLEDEKRRLQNEQEKHQEMRALLEKQQEIYPHVLLRCLSLLRQAASELRLRAQSDIDRINAEYLEAKSNALFLKLRMEELQVLTDCYTPEKVLVHRQIRDTLEAGVKKEKQELSTSRQILSSYEFLGPEFEGLVQEYTRLKDKIKDNRWMLQELSKSLP

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 4 Entity 4 polymer

Description description	HAUS augmin-like complex subunit 5
Molecular weight formula_weight	77357.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MERRSLAQELKKWAVEEMGLPAQKAPSEEMLQRLFIGQCGDIWKFIIRHIHSHRTVRKIEGNLLWYQQLQHTEAQRTAEEEQQQRRKQLCKEILELRAELHHLQEQIQTAEREIVGQDLNCERAQDLCRRSLLLRAFNKKREEECEALCQSNKKIQYRCEQLQEIRRASQREVMFSAVDPDLSSSTFLEPEVLRDVREVCKLRFKFLRSLHDDSISSSVHPGKEDLRSLSHQQWMSMAEKVWNTHTPNHILAALERLTLNSTQELKKLQFSQAADLSKGPSCQLKEFSEPITQSRSCNESTHLDPQETLPSFHSLIQEGWANSVKVSSELRRVQSQAQALSEHLAERIQEIHKKLSDGSEVSVLTRAAFDAELRCVILRGCRDALMQECRMLQEEAAGKKQEMKLLQQQQQNIQEACLLLDKKQKHIQILIKGNSSSKSQIRRSSVEAQKYVQDKLLPWPQEIIQESQRLQDSIQKEVKHFSAICLPALLKVSTDGFNLLPSRELSINRMSNTHAPYYGIFKGIYESVRLPLYKAPESVLSHVADMKKQLFFLRSQLSSRSEAISKTQRALQKNTNPDTDALLKSLSDHYSLELDEMVPKMQRLIQQCEKHQEYGKEVQATVMDWWEQPVQLCLPSEERGGLTLRQWRERWTVAVTALQRATGSRS

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 5 Entity 5 polymer

Description description	HAUS augmin like complex subunit 2 L homeolog
Molecular weight formula_weight	25135.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MMAANPWSPVQPSAASLLLEKCLAAGVLSQNALDQAQLEAPCFSHAEELQRITEIKAEINQKSLELELLRLEKETADITHPLYLGQKHQALQAMNSHLEAVLREKRSLRQRLAQPVCQENLPIEASYHRFTAELLPLAVNFIEKLEIYIKTIQTIPKIPDCASNMDNALMRMESLEAEMEEVTEQILTWREQQKTAFQMNSDANSSCITAQTSYLSIENLHP

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 6 Entity 6 polymer

Description description	HAUS augmin like complex subunit 6 L homeolog
Molecular weight formula_weight	110863.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MQSGSRPHLAWQREHMWLALQGLGFESGAEAANAGKTLVHVTFGVNMFDKPNKDAFYVVFHFLFGKLDNVRCKEVFRYCWPPLDKKRDAEFRKACCEWLKKISDEVGAGFPQVVASIFLSPGGPKFVHLLYHFARYVMLQHIKRDADAGNVFISEALQSKIQDPQKALARNKLARQKYLKVLQKENLVIEEYQRKAQLLIKQIRDMRSEHVALQNQQKLAEKVDRKISDKDENIQKTRCMWNTIMQMLKEMEKEVDVVDAVVRGNIDQYCLDGTNATLNIPNLLISRIESEMHRLQMDNVYEAGKVNLITVVQLLNEALKLVSGERSLYDCKGVRLDLQYLHGKAKFESEVLTRLRNMRHKIKREDLVSIEKIIADREREWERKWEKILGKCPFSLLKGLNPALELNPPMAPFSFDPASEEVLKSSVFCHYPASLQEYSHKEKPLKDFNQDHSGELVQRLIGATVLTRSGRKSTSSLGMATPNRRRMSLNEREFQTPTMNDRIGFQRTPSSAVQKRRADVSWKTAANSPLPCTPTPYKQDPKNMARQQLAQQVADYIVSESPRSSGGRGMELDDLLGVLSSDPFLSRKEIPRTPENLISDIRSSWRKAIQSEESLVVASPVAAPCMDSTAELESAHCSQIDLSMACFLSTSHASDQNDCSGTRIPHNTGGNKASSLHSDVVHHESIDMKSEIDSSQPEDLSLPIKENEPADKLINLLDDKKESENADTLTNPVEFIFSNQPISKLMDKTMFISVSGQENLSAHTTLSWNSSNMITSDSSSDTHEIIQFGILHETLPENAGNVSLNSTLSLGGNEEPFEKSELSDHDFTFDRKEHSSRSMEGKMDINSIRSRYEALKRTLTSLTDEEYHGDPDTSNMRFTKHKSESSLILGSDVYSPVEKVLSLDLEYLTTPSPKDRKLSLPQLISFSPETIRSEKQEDLLDVFESQDFVNPNKTFDFTSSGLDLQKSTDEGPEQLIKL

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 7 Entity 7 polymer

Description description	HAUS augmin like complex subunit 7 S homeolog
Molecular weight formula_weight	39379.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTGGKELGAAVELYERLQMLSCPCLEGVYLTDPQSIYELLCTPSSHRLDILQWLCSRIYPPVQEQLSSLKESQTDTKVKEIAKLCFDLMLCHFDDLDLIRGHASPFKQISFIGQLLDVIQYPDTISSNVILESLSHSTEKNVVTCIRENEELLKELFSSPHFQATLSPECNPWPADFKPLLNAEESLQKRATQSSKGKDMSNSVEALLEISSSLKALKEECVDLCSSVTDGDKVIQSLRLALTDFHQLTIAFNQIYANEFQEHCGHPAPHMSPMGPFFQFVHQSLSTCFKELESIAQFTETSENIVDVVRERHQSKEKWAGSTISTLCEKMKELRQSYEAFQQSSLQD

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 8 Entity 8 polymer

Description description	HAUS augmin-like complex subunit 8
Molecular weight formula_weight	41144.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSEAGVAPIEDGSQNSSGGSSGDAALKKSKGGAKVVKSRYMQIGRSKVSKNSLANTTVCSGGKVPERGSGGTPTRRSLAPHKAKITAAVPLPALDGSIFTKEDLQSTLLDGHRIARPDLDLSVINDRTLQKITPRPVVTSEQKKPKRDTTPVNLVPEDMVEMIESQTLLLTYLTIKMQKNLFRLEEKAERNLLLVNDQKDQLQETIHMMKRDLTLLQREERLRDLIEKQDEVLTPVVTSKDPFKDNYTTFATALDSTRHQLAIKNIHITGNRHRYLEELQKHLAITKSLLEEIMPSHASENAESFDTIKDLENIVLKTDEELARSFRQILDLSFKVNKEISLQSQKAVEETCESALVRQWYFDGSLP

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

▶

Resolution resolution	33.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	11969

Structure of the augmin holocomplex in open conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

HAUS augmin-like complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin-like complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin like complex subunit 4 L homeolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin-like complex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin like complex subunit 2 L homeolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin like complex subunit 6 L homeolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin like complex subunit 7 S homeolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HAUS augmin-like complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8at3__assembly_1__model_1

8at3__assembly_1__model_1 | I(q)

8at3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source