SAXSdb — 8b12

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major carboxysome shell protein CsoS1A

Halothiobacillus neapolitanus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 600	Carboxysome shell vertex protein CsoS4A × 60 （O85043） Carboxysome assembly protein CsoS2B × 60 （O85041） water × 600	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSOSA_HALNC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–98； UniProt 1–98 Author chain B； PDBConstruct 1–98； UniProt 1–98 Author chain C； PDBConstruct 1–98； UniProt 1–98 Author chain D； PDBConstruct 1–98； UniProt 1–98 Author chain E； PDBConstruct 1–98； UniProt 1–98 Author chain F； PDBConstruct 1–98； UniProt 1–98 Author chain H； PDBConstruct 1–98； UniProt 1–98 Author chain I； PDBConstruct 1–98； UniProt 1–98

Carboxysome shell vertex protein CsoS4A

Halothiobacillus neapolitanus

UniProt O85043

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 600	Major carboxysome shell protein CsoS1A × 480 （P45689） Carboxysome assembly protein CsoS2B × 60 （O85041） water × 600	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSS4A_HALNC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–83； UniProt 1–83

Carboxysome assembly protein CsoS2B

Halothiobacillus neapolitanus

UniProt O85041

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 600	Major carboxysome shell protein CsoS1A × 480 （P45689） Carboxysome shell vertex protein CsoS4A × 60 （O85043） water × 600	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSOS2_HALNC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain X； PDBConstruct 1–863； UniProt 7–869

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8b12
Deposition date deposition_date	2022-09-09
Structure title title	cryo-EM structure of carboxysomal mini-shell: icosahedral assembly from CsoS4A/1A and CsoS2 co-expression (T = 9)
Keywords keywords	carboxysome, shell, icosahedral symmetry, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8b12__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8b12__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8b12__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	160.90 Å
Total Rg	160.90 Å
Atom count	401100
Residues	56220
Excluded volume	7130700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8b12__assembly_1__model_1`	600-meric （600）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Major carboxysome shell protein CsoS1A
Molecular weight formula_weight	9973.5 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,H,I
Atom count atom_count	7170

MADVTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA

Source Source

Source organism organism	Halothiobacillus neapolitanus
NCBI taxonomy ID ncbi_taxonomy_id	927
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Carboxysome shell vertex protein CsoS4A
Molecular weight formula_weight	8900.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWNGE

Source Source

Source organism organism	Halothiobacillus neapolitanus
NCBI taxonomy ID ncbi_taxonomy_id	927
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Carboxysome assembly protein CsoS2B
Molecular weight formula_weight	91502.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MNPADLSGLSGKELARARRAALSKQGKAAVSNKTASVNRSTKQAASSINTNQVRSSVNEVPTDYQMADQLCSTIDHADFGTESNRVRDLCRQRREALSTIGKKAVKTNGKPSGRVRPQQSVVHNDAMIENAGDTNQSSSTSLNNELSEICSIADDMPERFGSQAKTVRDICRARRQALSERGTRAVPPKPQSQGGPGRNGYQIDGYLDTALHGRDAAKRHREMLCQYGRGTAPSCKPTGRVKNSVQSGNAAPKKVETGHTLSGGSVTGTQVDRKSHVTGNEPGTCRAVTGTEYVGTEQFTSFCNTSPKPNATKVNVTTTARGRPVSGTEVSRTEKVTGNESGVCRNVTGTEYMSNEAHFSLCGTAAKPSQADKVMFGATARTHQVVSGSDEFRPSSVTGNESGAKRTITGSQYADEGLARLTINGAPAKVARTHTFAGSDVTGTEIGRSTRVTGDESGSCRSISGTEYLSNEQFQSFCDTKPQRSPFKVGQDRTNKGQSVTGNLVDRSELVTGNEPGSCSRVTGSQYGQSKICGGGVGKVRSMRTLRGTSVSGQQLDHAPKMSGDERGGCMPVTGNEYYGREHFEPFCTSTPEPEAQSTEQSLTCEGQIISGTSVDASDLVTGNEIGEQQLISGDAYVGAQQTGCLPTSPRFNQTGNVQSMGFKNTNQPEQNFAPGEVMPTDFSIQTPARSAQNRITGNDIAPSGRITGPGMLATGLITGTPEFRHAARELVGSPQPMAMAMANRNKAAQAPVVQPEVVATQEKPELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG

Source Source

Source organism organism	Halothiobacillus neapolitanus
NCBI taxonomy ID ncbi_taxonomy_id	927
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	485

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.86 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	123500

cryo-EM structure of carboxysomal mini-shell: icosahedral assembly from CsoS4A/1A and CsoS2 co-expression (T = 9)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major carboxysome shell protein CsoS1A

State in the Current Structure

Other States of the Same Protein in the Database

Carboxysome shell vertex protein CsoS4A

State in the Current Structure

Other States of the Same Protein in the Database

Carboxysome assembly protein CsoS2B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8b12__assembly_1__model_1

8b12__assembly_1__model_1 | I(q)

8b12__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)

cryo-EM structure of carboxysomal mini-shell: icosahedral assembly from CsoS4A/1A and CsoS2 co-expression (T = 9)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major carboxysome shell protein CsoS1A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Carboxysome shell vertex protein CsoS4A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Carboxysome assembly protein CsoS2B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8b12__assembly_1__model_1

8b12__assembly_1__model_1 | I(q)

8b12__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)