8b6l

Subtomogram average of the human Sec61-TRAP-OSTA-translocon

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein transport protein Sec61 subunit alpha isoform 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S61A1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–476； UniProt 1–476

Protein transport protein Sec61 subunit beta

OrganismNot specified

UniProt P60468

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SC61B_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–96； UniProt 1–96

Protein transport protein Sec61 subunit gamma

OrganismNot specified

UniProt P60059

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SC61G_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–68； UniProt 1–68

Translocon-associated protein subunit alpha

OrganismNot specified

UniProt P43307

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSRA_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–286； UniProt 1–286

Translocon-associated protein subunit beta

OrganismNot specified

UniProt P43308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSRB_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–183； UniProt 1–183

Translocon-associated protein subunit gamma

OrganismNot specified

UniProt Q9UNL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSRG_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–185； UniProt 1–185

Translocon-associated protein subunit delta

OrganismNot specified

UniProt P51571

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSRD_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–173； UniProt 1–173

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A

OrganismNot specified

UniProt P46977

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STT3A_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–705； UniProt 1–705

Oligosaccharyltransferase complex subunit OSTC

OrganismNot specified

UniProt Q9NRP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OSTC_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–149； UniProt 1–149

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4

OrganismNot specified

UniProt P0C6T2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OST4_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–37； UniProt 1–37

Transmembrane protein 258

OrganismNot specified

UniProt P61165

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TM258_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–79； UniProt 1–79

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

OrganismNot specified

UniProt P61803

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DAD1_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–113； UniProt 1–113

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit

OrganismNot specified

UniProt P39656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OST48_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–456； UniProt 1–456

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1

OrganismNot specified

UniProt P04843

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN1_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain O； PDBConstruct 1–607； UniProt 1–607

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2

OrganismNot specified

UniProt P04844

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Signal peptide mix × 1 Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Transmembrane protein 258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN2_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain P； PDBConstruct 1–631； UniProt 1–631

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8b6l
Deposition date deposition_date	2022-09-27
Structure title title	Subtomogram average of the human Sec61-TRAP-OSTA-translocon
Keywords keywords	membrane protein complex, protein translocation, N-glycosylation, signal peptide insertion, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8b6l__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8b6l__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8b6l__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.72 Å
Rg (electron density)	64.67 Å
Total Rg	64.81 Å
Atom count	29611
Residues	3753
Excluded volume	534060 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8b6l__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Protein transport protein Sec61 subunit alpha isoform 1
Molecular weight formula_weight	52304.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	29611

MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF

Entity 2 Entity 2 polymer

Description description	Protein transport protein Sec61 subunit beta
Molecular weight formula_weight	9987.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS

Entity 3 Entity 3 polymer

Description description	Protein transport protein Sec61 subunit gamma
Molecular weight formula_weight	7752.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

Entity 4 Entity 4 polymer

Description description	Signal peptide mix
Molecular weight formula_weight	1890.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

XXXXXXXXXXXXXXXXXXXXXX

Entity 5 Entity 5 polymer

Description description	Translocon-associated protein subunit alpha
Molecular weight formula_weight	32263.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE

Entity 6 Entity 6 polymer

Description description	Translocon-associated protein subunit beta
Molecular weight formula_weight	20155.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN

Entity 7 Entity 7 polymer

Description description	Translocon-associated protein subunit gamma
Molecular weight formula_weight	21106.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK

Entity 8 Entity 8 polymer

Description description	Translocon-associated protein subunit delta
Molecular weight formula_weight	19015.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAAMASLGALALLLLSSLSRCSAEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA

Entity 9 Entity 9 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
Molecular weight formula_weight	80607.3 kDa
EC 编号 ec_number	2.4.99.18
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGLSRT

Entity 10 Entity 10 polymer

Description description	Oligosaccharyltransferase complex subunit OSTC
Molecular weight formula_weight	16844.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG

Entity 11 Entity 11 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4
Molecular weight formula_weight	4196.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE

Entity 12 Entity 12 polymer

Description description	Transmembrane protein 258
Molecular weight formula_weight	9083.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV

Entity 13 Entity 13 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Molecular weight formula_weight	12503.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Entity 14 Entity 14 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
Molecular weight formula_weight	50854.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MGYFRCARAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD

Entity 15 Entity 15 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
Molecular weight formula_weight	68656.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVALDPGAKISVIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL

Entity 16 Entity 16 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
Molecular weight formula_weight	69347.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKRTAH

▶

Resolution resolution	7.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	42215

Subtomogram average of the human Sec61-TRAP-OSTA-translocon

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein transport protein Sec61 subunit alpha isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein transport protein Sec61 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein transport protein Sec61 subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Translocon-associated protein subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Translocon-associated protein subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Translocon-associated protein subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Translocon-associated protein subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Oligosaccharyltransferase complex subunit OSTC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer