9ygy

Structure of a GRP94 folding intermediate engaged with a CCDC134- and FKBP11-bound secretory translocon

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Translocon-associated protein subunit alpha

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSRA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 5； PDBConstruct 1–286； UniProt 1–286

Translocon-associated protein subunit beta

OrganismNot specified

UniProt P43308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSRB_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 6； PDBConstruct 1–183； UniProt 1–183

Translocon-associated protein subunit gamma

OrganismNot specified

UniProt Q9UNL2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSRG_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 7； PDBConstruct 1–185； UniProt 1–185

Translocon-associated protein subunit delta

OrganismNot specified

UniProt P51571

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSRD_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 8； PDBConstruct 1–173； UniProt 1–173

Peptidyl-prolyl cis-trans isomerase FKBP11

OrganismNot specified

UniProt Q9NYL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FKB11_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–201； UniProt 1–201

Coiled-coil domain-containing protein 134

OrganismNot specified

UniProt Q9H6E4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CC134_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain B； PDBConstruct 1–229； UniProt 1–229

Protein transport protein Sec61 subunit alpha isoform 1

OrganismNot specified

UniProt P61619

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S61A1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D； PDBConstruct 1–476； UniProt 1–476

Protein transport protein Sec61 subunit beta

OrganismNot specified

UniProt P60468

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SC61B_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain E； PDBConstruct 1–96； UniProt 1–96

Protein transport protein Sec61 subunit gamma

OrganismNot specified

UniProt P60059

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SC61G_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain F； PDBConstruct 1–68； UniProt 1–68

Stress-associated endoplasmic reticulum protein 1

OrganismNot specified

UniProt Q9Y6X1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SERP1_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain G； PDBConstruct 1–66； UniProt 1–66

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A

OrganismNot specified

UniProt P46977

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STT3A_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain I； PDBConstruct 1–705； UniProt 1–705

Oligosaccharyltransferase complex subunit OSTC

OrganismNot specified

UniProt Q9NRP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OSTC_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain J； PDBConstruct 1–149； UniProt 1–149

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4

OrganismNot specified

UniProt P0C6T2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OST4_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain K2； PDBConstruct 1–37； UniProt 1–37

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258

OrganismNot specified

UniProt P61165

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TM258_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain L2； PDBConstruct 1–79； UniProt 1–79

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

OrganismNot specified

UniProt P61803

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DAD1_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain M2； PDBConstruct 1–113； UniProt 1–113

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2

OrganismNot specified

UniProt Q8N6L1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KTAP2_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain N； PDBConstruct 1–136； UniProt 1–136

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit

OrganismNot specified

UniProt P39656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OST48_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain N2； PDBConstruct 1–456； UniProt 1–456

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1

OrganismNot specified

UniProt P04843

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN1_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain O2； PDBConstruct 1–607； UniProt 1–607

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2

OrganismNot specified

UniProt P04844

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Endoplasmin × 1 （P14625） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN2_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain P2； PDBConstruct 1–631； UniProt 1–631

Endoplasmin

OrganismNot specified

UniProt P14625

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 其他Polymer 4	Translocon-associated protein subunit alpha × 1 （P43307） Translocon-associated protein subunit beta × 1 （P43308） Translocon-associated protein subunit gamma × 1 （Q9UNL2） Translocon-associated protein subunit delta × 1 （P51571） Peptidyl-prolyl cis-trans isomerase FKBP11 × 1 （Q9NYL4） Coiled-coil domain-containing protein 134 × 1 （Q9H6E4） Protein transport protein Sec61 subunit alpha isoform 1 × 1 （P61619） Protein transport protein Sec61 subunit beta × 1 （P60468） Protein transport protein Sec61 subunit gamma × 1 （P60059） Stress-associated endoplasmic reticulum protein 1 × 1 （Q9Y6X1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A × 1 （P46977） Oligosaccharyltransferase complex subunit OSTC × 1 （Q9NRP0） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 × 1 （P0C6T2） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258 × 1 （P61165） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 × 1 （P61803） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2 × 1 （Q8N6L1） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit × 1 （P39656） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 × 1 （P04843） Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 × 1 （P04844） ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose × 1 phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ENPL_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain y3； PDBConstruct 1–803； UniProt 1–803

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ygy
Deposition date deposition_date	2025-09-29
Structure title title	Structure of a GRP94 folding intermediate engaged with a CCDC134- and FKBP11-bound secretory translocon
Keywords keywords	Ribosome, Membrane protein, Translocon, Transport, N-Glycosylation; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ygy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ygy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ygy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.99 Å
Rg (electron density)	64.38 Å
Total Rg	64.52 Å
Atom count	74558
Residues	4669
Excluded volume	669860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ygy__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (25)

Entity 1 Entity 1 polymer

Description description	Translocon-associated protein subunit alpha
Molecular weight formula_weight	32263.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5
Atom count atom_count	74558

MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE

Entity 2 Entity 2 polymer

Description description	Translocon-associated protein subunit beta
Molecular weight formula_weight	20155.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN

Entity 3 Entity 3 polymer

Description description	Translocon-associated protein subunit gamma
Molecular weight formula_weight	21106.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK

Entity 4 Entity 4 polymer

Description description	Translocon-associated protein subunit delta
Molecular weight formula_weight	19015.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MAAMASLGALALLLLSSLSRCSAEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA

Entity 5 Entity 5 polymer

Description description	Peptidyl-prolyl cis-trans isomerase FKBP11
Molecular weight formula_weight	22213.4 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK

Entity 6 Entity 6 polymer

Description description	Coiled-coil domain-containing protein 134
Molecular weight formula_weight	26598.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL

Entity 7 Entity 7 polymer

Description description	Protein transport protein Sec61 subunit alpha isoform 1
Molecular weight formula_weight	52304.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF

Entity 8 Entity 8 polymer

Description description	Protein transport protein Sec61 subunit beta
Molecular weight formula_weight	9987.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS

Entity 9 Entity 9 polymer

Description description	Protein transport protein Sec61 subunit gamma
Molecular weight formula_weight	7752.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

Entity 10 Entity 10 polymer

Description description	Stress-associated endoplasmic reticulum protein 1
Molecular weight formula_weight	7384.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

Entity 11 Entity 11 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
Molecular weight formula_weight	80607.3 kDa
EC 编号 ec_number	2.4.99.18
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGLSRT

Entity 12 Entity 12 polymer

Description description	Oligosaccharyltransferase complex subunit OSTC
Molecular weight formula_weight	16844.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG

Entity 13 Entity 13 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4
Molecular weight formula_weight	4196.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K2

MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE

Entity 14 Entity 14 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258
Molecular weight formula_weight	9083.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L2

MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV

Entity 15 Entity 15 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Molecular weight formula_weight	12503.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M2

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Entity 16 Entity 16 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2
Molecular weight formula_weight	14689.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN

Entity 17 Entity 17 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
Molecular weight formula_weight	50854.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N2

MGYFRCARAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD

Entity 18 Entity 18 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
Molecular weight formula_weight	68656.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O2

MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVALDPGAKISVIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKIDHILDAL

Entity 19 Entity 19 polymer

Description description	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
Molecular weight formula_weight	69347.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P2

MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKRTAH

Entity 20 Entity 20 polymer

Description description	Endoplasmin
Molecular weight formula_weight	96254.2 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y3

MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKESTAEKDELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 21 Entity 21 branched

Description description	;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	1397.2 kDa
Source method src_method	man
Copy count entity_count	1

Entity 22 Entity 22 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	1

Entity 23 Entity 23 branched

Description description	;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	1397.2 kDa
Source method src_method	man
Copy count entity_count	1

Entity 24 Entity 24 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	1

Entity 25 Entity 25 non-polymer

Description description	phosphono [(3~{R},6~{E},10~{E})-3,7,11,15-tetramethylhexadeca-6,10,14-trienyl] hydrogen phosphate
Molecular weight formula_weight	452.5 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	55750

Structure of a GRP94 folding intermediate engaged with a CCDC134- and FKBP11-bound secretory translocon

1. Protein Identity and Related Structures Protein Identity & Related Structures

Translocon-associated protein subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Translocon-associated protein subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Translocon-associated protein subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Translocon-associated protein subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Peptidyl-prolyl cis-trans isomerase FKBP11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Coiled-coil domain-containing protein 134

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein transport protein Sec61 subunit alpha isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein transport protein Sec61 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein transport protein Sec61 subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Stress-associated endoplasmic reticulum protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer