SAXSdb — 8c5v

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chemotaxis protein CheA

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Chemotaxis protein CheW × 4 （P0A964） Methyl-accepting chemotaxis protein I × 12 （P02942）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CHEA_ECOLI
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–391； UniProt 257–647 Author chain B； PDBConstruct 1–391； UniProt 257–647 Author chain C； PDBConstruct 1–131； UniProt 1–131 Author chain D； PDBConstruct 1–131； UniProt 1–131

Chemotaxis protein CheW

OrganismNot specified

UniProt P0A964

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Chemotaxis protein CheA × 2 （P07363） Chemotaxis protein CheA × 2 （P07363） Methyl-accepting chemotaxis protein I × 12 （P02942）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CHEW_ECOLI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–143； UniProt 15–157 Author chain F； PDBConstruct 1–143； UniProt 15–157 Author chain G； PDBConstruct 1–143； UniProt 15–157 Author chain H； PDBConstruct 1–143； UniProt 15–157

Methyl-accepting chemotaxis protein I

OrganismNot specified

UniProt P02942

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Chemotaxis protein CheA × 2 （P07363） Chemotaxis protein CheA × 2 （P07363） Chemotaxis protein CheW × 4 （P0A964）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCP1_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–516； UniProt 1–516 Author chain J； PDBConstruct 1–516； UniProt 1–516 Author chain K； PDBConstruct 1–516； UniProt 1–516 Author chain L； PDBConstruct 1–516； UniProt 1–516 Author chain M； PDBConstruct 1–516； UniProt 1–516 Author chain N； PDBConstruct 1–516； UniProt 1–516 Author chain O； PDBConstruct 1–516； UniProt 1–516 Author chain P； PDBConstruct 1–516； UniProt 1–516 Author chain Q； PDBConstruct 1–516； UniProt 1–516 Author chain R； PDBConstruct 1–516； UniProt 1–516 Author chain S； PDBConstruct 1–516； UniProt 1–516 Author chain T； PDBConstruct 1–516； UniProt 1–516

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8c5v
Deposition date deposition_date	2023-01-10
Structure title title	Chemotaxis core signalling unit from E protein lysed E. coli cells
Keywords keywords	Chemotaxis, Signal Transduction, Membrane Protein; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8c5v__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8c5v__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8c5v__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	124.50 Å
Total Rg	123.80 Å
Atom count	59156
Residues	7808
Excluded volume	1048200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8c5v__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Chemotaxis protein CheA
Molecular weight formula_weight	42462.6 kDa
EC 编号 ec_number	2.7.13.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	59156

RSNESTSIRVAVEKVDQLINLVGELVITQSMLAQRSSELDPVNHGDLITSMGQLQRNARDLQESVMSIRMMPMEYVFSRYPRLVRDLAGKLGKQVELTLVGSSTELDKSLIERIIDPLTHLVRNSLDHGIELPEKRLAAGKNSVGNLILSAEHQGGNICIEVTDDGAGLNRERILAKAASQGLTVSENMSDDEVAMLIFAPGFSTAEQVTDVSGRGVGMDVVKRNIQKMGGHVEIQSKQGTGTTIRILLPLTLAILDGMSVRVADEVFILPLNAVMESLQPREADLHPLAGGERVLEVRGEYLPIVELWKVFNVAGAKTEATQGIVVILQSGGRRYALLVDQLIGQHQVVVKNLESNYRKVPGISAATILGDGSVALIVDVSALQAINREQ

Entity 2 Entity 2 polymer

Description description	Chemotaxis protein CheA
Molecular weight formula_weight	14874.6 kDa
EC 编号 ec_number	2.7.13.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MSMDISDFYQTFFDEADELLADMEQHLLVLQPEAPDAEQLNAIFRAAHSIKGGAGTFGFSVLQETTHLMENLLDEARRGEMQLNTDIINLFLETKDIMQEQLDAYKQSQEPDAASFDYICQALRQLALEAK

Entity 3 Entity 3 polymer

Description description	Chemotaxis protein CheW
Molecular weight formula_weight	15675.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

SGQEFLVFTLGDEEYGIDILKVQEIRGYDQVTRIANTPAFIKGVTNLRGVIVPIVDLRIKFSQVDVDYNDNTVVIVLNLGQRVVGIVVDGVSDVLSLTAEQIRPAPEFAVTLSTEYLTGLGALGDRMLILVNIEKLLNSEEMA

Entity 4 Entity 4 polymer

Description description	Methyl-accepting chemotaxis protein I
Molecular weight formula_weight	55562.4 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,L,M,N,O,P,Q,R,S,T

MLKRIKIVTSLLLVLAVFGLLQLTSGGLFFNALKNDKENFTVLQTIRQQQSTLNGSWVALLQTRNTLNRAGIRYMMDQNNIGSGSTVAELMESASISLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNALAELIQLLGAGKINEFFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAVSDNNASYSQAMWILVGVMIVVLAVIFAVWFGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFR

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	12.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	5100

Chemotaxis core signalling unit from E protein lysed E. coli cells

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chemotaxis protein CheA

State in the Current Structure

Other States of the Same Protein in the Database

Chemotaxis protein CheW

State in the Current Structure

Other States of the Same Protein in the Database

Methyl-accepting chemotaxis protein I

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8c5v__assembly_1__model_1

8c5v__assembly_1__model_1 | I(q)

8c5v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)

Chemotaxis core signalling unit from E protein lysed E. coli cells

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chemotaxis protein CheA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chemotaxis protein CheW

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Methyl-accepting chemotaxis protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8c5v__assembly_1__model_1

8c5v__assembly_1__model_1 | I(q)

8c5v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)