SAXSdb — 8dfs

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

pre-crRNA processing endonuclease

Desulfovibrio vulgaris

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	CRISPR-associated protein, TM1801 family × 7 （Q72WF7） CRISPR-associated protein, CT1133 family × 1 （Q72WF8） CRISPR-associated protein, CT1133 family × 2 （Q72WF8） RNA (48-MER) × 1 Anti-CRISPR protein 30 × 1 （Q6TM72）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q72WF9_DESVH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–227； UniProt 1–227

CRISPR-associated protein, TM1801 family

Desulfovibrio vulgaris

UniProt Q72WF7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	pre-crRNA processing endonuclease × 1 （Q72WF9） CRISPR-associated protein, CT1133 family × 1 （Q72WF8） CRISPR-associated protein, CT1133 family × 2 （Q72WF8） RNA (48-MER) × 1 Anti-CRISPR protein 30 × 1 （Q6TM72）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q72WF7_DESVH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–290； UniProt 1–290 Author chain C； PDBConstruct 1–290； UniProt 1–290 Author chain D； PDBConstruct 1–290； UniProt 1–290 Author chain E； PDBConstruct 1–290； UniProt 1–290 Author chain F； PDBConstruct 1–290； UniProt 1–290 Author chain G； PDBConstruct 1–290； UniProt 1–290 Author chain H； PDBConstruct 1–290； UniProt 1–290

CRISPR-associated protein, CT1133 family

Desulfovibrio vulgaris str. Hildenborough

UniProt Q72WF8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	pre-crRNA processing endonuclease × 1 （Q72WF9） CRISPR-associated protein, TM1801 family × 7 （Q72WF7） RNA (48-MER) × 1 Anti-CRISPR protein 30 × 1 （Q6TM72）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q72WF8_DESVH
Isoform	—
PDB entities	3, 4
Chains and sequence ranges	Author chain I； PDBConstruct 1–612； UniProt 1–612 Author chain J； PDBConstruct 1–124； UniProt 489–612 Author chain K； PDBConstruct 1–124； UniProt 489–612

Anti-CRISPR protein 30

Casadabanvirus D3112

UniProt Q6TM72

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	pre-crRNA processing endonuclease × 1 （Q72WF9） CRISPR-associated protein, TM1801 family × 7 （Q72WF7） CRISPR-associated protein, CT1133 family × 1 （Q72WF8） CRISPR-associated protein, CT1133 family × 2 （Q72WF8） RNA (48-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACR30_BPD31
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–90； UniProt 1–90

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8dfs
Deposition date deposition_date	2022-06-22
Structure title title	type I-C Cascade bound to AcrIF2
Keywords keywords	CRISPR, Cascade, Type I-C, anti-CRISPR, IF2, DNA BINDING PROTEIN, RNA BINDING PROTEIN-RNA complex; RNA BINDING PROTEIN/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8dfs__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8dfs__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8dfs__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.31 Å
Rg (electron density)	60.06 Å
Total Rg	59.95 Å
Atom count	49778
Residues	3130
Excluded volume	443860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8dfs__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	pre-crRNA processing endonuclease
Molecular weight formula_weight	25977.9 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	49778

MTHGAVKTYGIRLRVWGDYACFTRPEMKVERVSYDVMPPSAARGILEAIHWKPAIRWIVDRIHVLRPIVFDNVRRNEVSSKIPKPNPATAMRDRKPLYFLVDDGSNRQQRAATLLRNVDYVIEAHFELTDKAGAEDNAGKHLDIFRRRARAGQSFQQPCLGCREFPASFELLEGDVPLSCYAGEKRDLGYMLLDIDFERDMTPLFFKAVMEDGVITPPSRTSPEVRA

Source Source

Source organism organism	Desulfovibrio vulgaris
NCBI taxonomy ID ncbi_taxonomy_id	882
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	CRISPR-associated protein, TM1801 family
Molecular weight formula_weight	32358.9 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C,D,E,F,G,H

MTAIANRYEFVLLFDVENGNPNGDPDAGNMPRIDPETGHGLVTDVCLKRKIRNHVALTKEGAERFNIYIQEKAILNETHERAYTACDLKPEPKKLPKKVEDAKRVTDWMCTNFYDIRTFGAVMTTEVNCGQVRGPVQMAFARSVEPVVPQEVSITRMAVTTKAEAEKQQGDNRTMGRKHIVPYGLYVAHGFISAPLAEKTGFSDEDLTLFWDALVNMFEHDRSAARGLMSSRKLIVFKHQNRLGNAPAHKLFDLVKVSRAEGSSGPARSFADYAVTVGQAPEGVEVKEML

Source Source

Source organism organism	Desulfovibrio vulgaris
NCBI taxonomy ID ncbi_taxonomy_id	882
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	CRISPR-associated protein, CT1133 family
Molecular weight formula_weight	68123.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MILQALHGYYQRMSADPDAGMPPYGTSMENISFALVLDAKGTLRGIEDLREQEGKKLRPRKMLVPIAEKKGNGIKPNFLWENTSYILGVDAKGKQERTDKCHAAFIAHIKAYCDTADQDLAAVLQFLEHGEKDLSAFPVSEEVIGSNIVFRIEGEPGFVHERPAARQAWANCLNRREQGLCGQCLITGERQKPIAQLHPSIKGGRDGVRGAQAVASIVSFNNTAFESYGKEQSINAPVSQEAAFSYVTALNYLLNPSNRQKVTIADATVVFWAERSSPAEDIFAGMFDPPSTTAKPESSNGTPPEDSEEGSQPDTARDDPHAAARMHDLLVAIRSGKRATDIMPDMDESVRFHVLGLSPNAARLSVRFWEVDTVGHMLDKVGRHYRELEIIPQFNNEQEFPSLSTLLRQTAVLNKTENISPVLAGGLFRAMLTGGPYPQSLLPAVLGRIRAEHARPEDKSRYRLEVVTYYRAALIKAYLIRNRKLEVPVSLDPARTDRPYLLGRLFAVLEKAQEDAVPGANATIKDRYLASASANPGQVFHMLLKNASNHTAKLRKDPERKGSAIHYEIMMQEIIDNISDFPVTMSSDEQGLFMIGYYHQRKALFTKKNKEN

Source Source

Source organism organism	Desulfovibrio vulgaris str. Hildenborough
NCBI taxonomy ID ncbi_taxonomy_id	882
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	CRISPR-associated protein, CT1133 family
Molecular weight formula_weight	14018.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K

VSLDPARTDRPYLLGRLFAVLEKAQEDAVPGANATIKDRYLASASANPGQVFHMLLKNASNHTAKLRKDPERKGSAIHYEIMMQEIIDNISDFPVTMSSDEQGLFMIGYYHQRKALFTKKNKEN

Source Source

Source organism organism	Desulfovibrio vulgaris str. Hildenborough
NCBI taxonomy ID ncbi_taxonomy_id	882
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	RNA (48-MER)
Molecular weight formula_weight	15476.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	L

GGAUUGAAACGCCAUGCUCAGGCUGGCGAGUGCGCGCCACUCAUCAAG

Source Source

Source organism organism	Desulfovibrio vulgaris
NCBI taxonomy ID ncbi_taxonomy_id	882
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Anti-CRISPR protein 30
Molecular weight formula_weight	9931.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MIAQQHKDTVAACEAAEAIAIAKDQVWDGEGYTKYTFDDNSVLIQSGTTQYAMDADDADSIKGYADWLDDEARSAEASEIERLLESVEEE

Source Source

Source organism organism	Casadabanvirus D3112
NCBI taxonomy ID ncbi_taxonomy_id	10708
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	21625

type I-C Cascade bound to AcrIF2

1. Protein Identity and Related Structures Protein Identity & Related Structures

pre-crRNA processing endonuclease

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated protein, TM1801 family

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated protein, CT1133 family

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anti-CRISPR protein 30

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8dfs__assembly_1__model_1

8dfs__assembly_1__model_1 | I(q)

8dfs__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (1)