SAXSdb — 8ema

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Isoform 2 of Immunoglobulin heavy constant mu

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 1–475 Chain B； UniProt 1–475	Not recorded	Anti-human Langerin 2G3 lambda chain × 2 （G0YP42） B-cell antigen receptor complex-associated protein alpha chain × 1 （P11911,P21578） B-cell antigen receptor complex-associated protein beta chain × 1 （P15530）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	IGHM_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 141–615； UniProt 1–475 Author chain B； PDBConstruct 141–615； UniProt 1–475

Isoform 2 of Immunoglobulin heavy constant mu

Mus musculus

UniProt P06328

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 1–117 Chain B； UniProt 1–117	Not recorded	Anti-human Langerin 2G3 lambda chain × 2 （G0YP42） B-cell antigen receptor complex-associated protein alpha chain × 1 （P11911,P21578） B-cell antigen receptor complex-associated protein beta chain × 1 （P15530）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8EMA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1NGW Chimeric Affinity Matured Fab 7g12 complexed with mesoporphyrin Deposited 2002-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 27–117（91 aa） Fragment：germline Fab fragment	Not recorded	MMP N-METHYLMESOPORPHYRIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；PEG2000MME, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 100K	Resolution 2.60 Å R-free 0.318
1NGW Chimeric Affinity Matured Fab 7g12 complexed with mesoporphyrin Deposited 2002-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 27–117（91 aa） Fragment：germline Fab fragment	Not recorded	MMP N-METHYLMESOPORPHYRIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；PEG2000MME, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 100K	Resolution 2.60 Å R-free 0.318

1 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HVM49_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–117； UniProt 1–117 Author chain B； PDBConstruct 1–117； UniProt 1–117

Anti-human Langerin 2G3 lambda chain

Mus musculus

UniProt G0YP42

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain L； UniProt 1–234 Chain R； UniProt 1–234	Not recorded	Isoform 2 of Immunoglobulin heavy constant mu × 2 （P06328,P01872-2） B-cell antigen receptor complex-associated protein alpha chain × 1 （P11911,P21578） B-cell antigen receptor complex-associated protein beta chain × 1 （P15530）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8EMA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å

5 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0YP42_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain L； PDBConstruct 1–234； UniProt 1–234 Author chain R； PDBConstruct 1–234； UniProt 1–234

B-cell antigen receptor complex-associated protein alpha chain

Aliivibrio fischeri

UniProt P11911

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain C； UniProt 1–172	Not recorded	Isoform 2 of Immunoglobulin heavy constant mu × 2 （P06328,P01872-2） Anti-human Langerin 2G3 lambda chain × 2 （G0YP42） B-cell antigen receptor complex-associated protein beta chain × 1 （P15530）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8EMA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8E4C IgM BCR fab truncated form Deposited 2022-08-18	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–169（169 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CD79A_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 9–180； UniProt 1–172

B-cell antigen receptor complex-associated protein alpha chain

Aliivibrio fischeri

UniProt P21578

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain C； UniProt 1–194	Not recorded	Isoform 2 of Immunoglobulin heavy constant mu × 2 （P06328,P01872-2） Anti-human Langerin 2G3 lambda chain × 2 （G0YP42） B-cell antigen receptor complex-associated protein beta chain × 1 （P15530）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8EMA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8E4C IgM BCR fab truncated form Deposited 2022-08-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–194（194 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LUXY_ALIFS
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 185–378； UniProt 1–194

B-cell antigen receptor complex-associated protein beta chain

Mus musculus

UniProt P15530

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain D； UniProt 1–228	Not recorded	Isoform 2 of Immunoglobulin heavy constant mu × 2 （P06328,P01872-2） Anti-human Langerin 2G3 lambda chain × 2 （G0YP42） B-cell antigen receptor complex-associated protein alpha chain × 1 （P11911,P21578）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 8.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8EMA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3KHO Crystal structure of murine Ig-beta (CD79b) homodimer Deposited 2009-10-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–159（133 aa） Chain B 27–159（133 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；298 K；0.7-1.0 M Ammonium Sulfate, 100mM Tris, pH 8.0, VAPOR DIFFUSION, temperature 298K	Resolution 3.11 Å R-free 0.258
3KHQ Crystal structure of murine Ig-beta (CD79b) in the monomeric form Deposited 2009-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–159（133 aa） Fragment：extracellular domain	Not recorded	MG MAGNESIUM ION × 1 FLC CITRATE ANION × 1 GSH Glutathione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5；298 K；20% Peg 750 MME, 0.2M MgCl2, 100mM Na Citrate, pH 5.0, VAPOR DIFFUSION, temperature 298K	Resolution 1.70 Å R-free 0.197
8E4C IgM BCR fab truncated form Deposited 2022-08-18	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–228（228 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CD79B_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–228； UniProt 1–228

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ema
Deposition date deposition_date	2022-09-27
Structure title title	mouse full length B cell receptor
Keywords keywords	COMPLEX, MEMBRANE PROTEIN, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	68.70 Å
Radius of gyration Rg (electron density) rg_electron	70.26 Å
Forward intensity I(0) i0	629881000.00
Molecular weight molecular_weight	211040.0 kDa
Excluded volume excluded_volume	264560 Å³
Envelope volume envelope_volume	471490 Å³
Hydration-shell volume shell_volume	64894 Å³
Envelope diameter envelope_diameter	252.8 Å
Shell Rg shell_rg	55.49 Å
Envelope Rg envelope_rg	67.16 Å
Shape Rg shape_rg	70.31 Å
Total Rg total_rg	69.67 Å
Total atoms total_atoms	14871
Residues n_residues	1911
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	233.5 Å
Rg (real space) rg_real	69.24 Å
Rg uncertainty (real space) rg_real_error	2.92 Å
I(0) (real space) i0_real	6.2980e+08
I(0) uncertainty (real space) i0_real_error	1.4740e+07
Rg (reciprocal space) rg_reciprocal	66.62 Å
I(0) (reciprocal space) i0_reciprocal	626800000.0000
Solution quality estimate total_estimate	0.7680
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	50.8 Å
Skewness Skewness skewness	0.514
Kurtosis Kurtosis kurtosis	-0.466
Angular range angular_range	— – 0.1150 Å⁻¹
Current regularization parameter α current_alpha	0.0002
Highest regularization parameter α highest_alpha	22940000.0000
Real-space data points n_real_points	24
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.692; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.612; Smooth: 0.295

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Isoform 2 of Immunoglobulin heavy constant mu
Molecular weight formula_weight	68133.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	14871

MGWSCIILFLVATATGVHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTLTVSSESQSFPNVFPLVSCESPLSDKNLVAMGCLARDFLPSTISFTWNYQNNTEVIQGIRTFPTLRTGGKYLATSQVLLSPKSILEGSDEYLVCKIHYGGKNRDLHVPIPAVAEMNPNVNVFVPPRDGFSGPAPRKSKLICEATNFTPKPITVSWLKDGKLVESGFTTDPVTIENKGSTPQTYKVISTLTISEIDWLNLNVYTCRVDHRGLTFLKNVSSTCAASPSTDILTFTIPPSFADIFLSKSANLTCLVSNLATYETLNISWASQSGEPLETKIKIMESHPNGTFSAKGVASVCVEDWNNRKEFVCTVTHRDLPSPQKKFISKPNEVHKHPPAVYLLPPAREQLNLRESATVTCLVKGFSPADISVQWLQRGQLLPQEKYVTSAPMPEPGAPGFYFTHSILTVTEEEWNSGETYTCVVGHEALPHLVTERTVDKSTEGEVNAEEEGFENLWTTASTFIVLFLLSLFYSTTVTLFKVK

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Mus musculus

Entity 2 Entity 2 polymer

Description description	Anti-human Langerin 2G3 lambda chain
Molecular weight formula_weight	25058.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,L

MAWISLILSLLALSSGAISQAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRADCS

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Mus musculus

Entity 3 Entity 3 polymer

Description description	B-cell antigen receptor complex-associated protein alpha chain
Molecular weight formula_weight	42837.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

DYKDDDDKMPGGLEALRALPLLLFLSYACLGPGCQALRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGRSIATRSMFKGIVEGIGIIEKIDIYTDLDKYAIRFPENMLNGIKKESSIMFNGCFLTVTSVNSNIVWFDIFEKEARKLDTFREYKVGDRVNLGTFPKFGAASGGHILSARISCVASIIEIIENEDYQQMWIQIPENFTEFLIDKDYIAVDGISLTIDTIKNNQFFISLPLKIAQNTNMKWRKKGDKVNVELSNKINANQCW

来源 Source

来源生物 organism	Aliivibrio fischeri
NCBI Class编号 ncbi_taxonomy_id	668
宿主生物 host_organism	Mus musculus

Entity 4 Entity 4 polymer

Description description	B-cell antigen receptor complex-associated protein beta chain
Molecular weight formula_weight	25752.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Mus musculus

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	8.20 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	30218

fit	/app/data/saxs_computation/em/8ema/8ema.fit
pddf	/app/data/pr_computation/em/8ema/8ema.pr.out
profile	/app/data/saxs_computation/em/8ema/8ema.dat

mouse full length B cell receptor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Isoform 2 of Immunoglobulin heavy constant mu

State in the Current Structure

Other States of the Same Protein in the Database

Isoform 2 of Immunoglobulin heavy constant mu

State in the Current Structure

Other States of the Same Protein in the Database

Anti-human Langerin 2G3 lambda chain

State in the Current Structure

Other States of the Same Protein in the Database

B-cell antigen receptor complex-associated protein alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

B-cell antigen receptor complex-associated protein alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

B-cell antigen receptor complex-associated protein beta chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)