6mw9

CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody

Method: ELECTRON MICROSCOPY D_max: 235.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1

Eastern equine encephalitis virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 960 PDB declaration: 960-meric（960） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain E； UniProt 802–1242 Chain I； UniProt 802–1242 Chain M； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 240 （E9KXL2） EEEV-3 antibody heavy chain × 240 EEEV-3 antibody light chain × 240 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
2	Protein heterocomplex Heteromer Protein × 16 PDB declaration: hexadecameric（16） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain E； UniProt 802–1242 Chain I； UniProt 802–1242 Chain M； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 4 （E9KXL2） EEEV-3 antibody heavy chain × 4 EEEV-3 antibody light chain × 4 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
3	Protein heterocomplex Heteromer Protein × 80 PDB declaration: 80-meric（80） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain E； UniProt 802–1242 Chain I； UniProt 802–1242 Chain M； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 20 （E9KXL2） EEEV-3 antibody heavy chain × 20 EEEV-3 antibody light chain × 20 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
4	Protein heterocomplex Heteromer Protein × 96 PDB declaration: 96-meric（96） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain E； UniProt 802–1242 Chain I； UniProt 802–1242 Chain M； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 24 （E9KXL2） EEEV-3 antibody heavy chain × 24 EEEV-3 antibody light chain × 24 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
5	Protein heterocomplex Heteromer Protein × 16 PDB declaration: hexadecameric（16） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain E； UniProt 802–1242 Chain I； UniProt 802–1242 Chain M； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 4 （E9KXL2） EEEV-3 antibody heavy chain × 4 EEEV-3 antibody light chain × 4 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6MW9	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 240	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 72 PDB declaration: 72-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 480 PDB declaration: 480-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 40 PDB declaration: 40-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
9YAW Localized reconstruction of the asymmetric unit of SINV/EEEV in complex with Fab EEEV-33 at arm 4 at pH 5.6. Deposited 2025-09-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: 14-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain B 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain D 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 5.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9YB3 Localized reconstruction of the asymmetric unit of SINV/EEEV. Deposited 2025-09-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain B 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain D 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9YB4 Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV. Deposited 2025-09-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain B 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain D 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

9 other PDB entries and 33 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	E9KXM2_EEEV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–441； UniProt 802–1242 Author chain E； PDBConstruct 1–441； UniProt 802–1242 Author chain I； PDBConstruct 1–441； UniProt 802–1242 Author chain M； PDBConstruct 1–441； UniProt 802–1242

E2

Eastern equine encephalitis virus

UniProt E9KXL2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 960 PDB declaration: 960-meric（960） Consistent with protein copy count	Chain B； UniProt 325–744 Chain F； UniProt 325–744 Chain J； UniProt 325–744 Chain N； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 240 （E9KXM2） EEEV-3 antibody heavy chain × 240 EEEV-3 antibody light chain × 240 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
2	Protein heterocomplex Heteromer Protein × 16 PDB declaration: hexadecameric（16） Consistent with protein copy count	Chain B； UniProt 325–744 Chain F； UniProt 325–744 Chain J； UniProt 325–744 Chain N； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 4 （E9KXM2） EEEV-3 antibody heavy chain × 4 EEEV-3 antibody light chain × 4 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
3	Protein heterocomplex Heteromer Protein × 80 PDB declaration: 80-meric（80） Consistent with protein copy count	Chain B； UniProt 325–744 Chain F； UniProt 325–744 Chain J； UniProt 325–744 Chain N； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 20 （E9KXM2） EEEV-3 antibody heavy chain × 20 EEEV-3 antibody light chain × 20 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
4	Protein heterocomplex Heteromer Protein × 96 PDB declaration: 96-meric（96） Consistent with protein copy count	Chain B； UniProt 325–744 Chain F； UniProt 325–744 Chain J； UniProt 325–744 Chain N； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 24 （E9KXM2） EEEV-3 antibody heavy chain × 24 EEEV-3 antibody light chain × 24 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
5	Protein heterocomplex Heteromer Protein × 16 PDB declaration: hexadecameric（16） Consistent with protein copy count	Chain B； UniProt 325–744 Chain F； UniProt 325–744 Chain J； UniProt 325–744 Chain N； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 4 （E9KXM2） EEEV-3 antibody heavy chain × 4 EEEV-3 antibody light chain × 4 （G0YP42）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6MW9	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 720 PDB declaration: 720-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain E 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain H 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain K 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 240	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain E 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain H 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain K 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 60 PDB declaration: 60-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain E 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain H 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain K 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 72 PDB declaration: 72-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain E 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain H 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain K 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain E 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain H 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain K 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 480 PDB declaration: 480-meric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 40 PDB declaration: 40-meric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 48 PDB declaration: 48-meric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
9YAX Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV in complex with Fab fragment of the antibody EEEV-179 Deposited 2025-09-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: 17-meric	Chain a 325–744（420 aa） Fragment：UNP residues 325-744 Chain b 325–744（420 aa） Fragment：UNP residues 325-744 Chain c 325–744（420 aa） Fragment：UNP residues 325-744 Chain d 325–744（420 aa） Fragment：UNP residues 325-744 Chain e 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9YAZ Localized reconstruction of the asymmetric unit of SINV/EEEV in complex with Fab EEEV-179 at 40C sample. Deposited 2025-09-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: 17-meric	Chain a 325–744（420 aa） Fragment：UNP residues 325-744 Chain b 325–744（420 aa） Fragment：UNP residues 325-744 Chain c 325–744（420 aa） Fragment：UNP residues 325-744 Chain d 325–744（420 aa） Fragment：UNP residues 325-744 Chain e 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9YB1 Localized reconstruction of the asymmetric unit of SINV/EEEV at pH 5.6. Deposited 2025-09-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain a 325–744（420 aa） Fragment：UNP residues 325-744 Chain b 325–744（420 aa） Fragment：UNP residues 325-744 Chain c 325–744（420 aa） Fragment：UNP residues 325-744 Chain d 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 5.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
9YB2 Localized reconstruction of the asymmetric unit of SINV/EEEV at 40C sample. Deposited 2025-09-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain a 325–744（420 aa） Fragment：UNP residues 325-744 Chain b 325–744（420 aa） Fragment：UNP residues 325-744 Chain c 325–744（420 aa） Fragment：UNP residues 325-744 Chain d 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

10 other PDB entries and 34 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	E9KXL2_EEEV
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–420； UniProt 325–744 Author chain F； PDBConstruct 1–420； UniProt 325–744 Author chain J； PDBConstruct 1–420； UniProt 325–744 Author chain N； PDBConstruct 1–420； UniProt 325–744

EEEV-3 antibody light chain

OrganismNot specified

UniProt G0YP42

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 960 PDB declaration: 960-meric（960） Consistent with protein copy count	Chain D； UniProt 117–233 Chain H； UniProt 117–233 Chain L； UniProt 117–233 Chain P； UniProt 117–233	Fragment：Fab	E1 × 240 （E9KXM2） E2 × 240 （E9KXL2） EEEV-3 antibody heavy chain × 240	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
2	Protein heterocomplex Heteromer Protein × 16 PDB declaration: hexadecameric（16） Consistent with protein copy count	Chain D； UniProt 117–233 Chain H； UniProt 117–233 Chain L； UniProt 117–233 Chain P； UniProt 117–233	Fragment：Fab	E1 × 4 （E9KXM2） E2 × 4 （E9KXL2） EEEV-3 antibody heavy chain × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
3	Protein heterocomplex Heteromer Protein × 80 PDB declaration: 80-meric（80） Consistent with protein copy count	Chain D； UniProt 117–233 Chain H； UniProt 117–233 Chain L； UniProt 117–233 Chain P； UniProt 117–233	Fragment：Fab	E1 × 20 （E9KXM2） E2 × 20 （E9KXL2） EEEV-3 antibody heavy chain × 20	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
4	Protein heterocomplex Heteromer Protein × 96 PDB declaration: 96-meric（96） Consistent with protein copy count	Chain D； UniProt 117–233 Chain H； UniProt 117–233 Chain L； UniProt 117–233 Chain P； UniProt 117–233	Fragment：Fab	E1 × 24 （E9KXM2） E2 × 24 （E9KXL2） EEEV-3 antibody heavy chain × 24	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å
5	Protein heterocomplex Heteromer Protein × 16 PDB declaration: hexadecameric（16） Consistent with protein copy count	Chain D； UniProt 117–233 Chain H； UniProt 117–233 Chain L； UniProt 117–233 Chain P； UniProt 117–233	Fragment：Fab	E1 × 4 （E9KXM2） E2 × 4 （E9KXL2） EEEV-3 antibody heavy chain × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 7.30 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6MW9	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Parsed fields agree	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain D 117–233（117 aa） Fragment：Fab Chain H 117–233（117 aa） Fragment：Fab Chain L 117–233（117 aa） Fragment：Fab Chain P 117–233（117 aa） Fragment：Fab	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
8EMA mouse full length B cell receptor Deposited 2022-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain L 1–234（234 aa） Chain R 1–234（234 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.20 Å

5 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0YP42_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 98–214； UniProt 117–233 Author chain H； PDBConstruct 98–214； UniProt 117–233 Author chain L； PDBConstruct 98–214； UniProt 117–233 Author chain P； PDBConstruct 98–214； UniProt 117–233

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6mw9
Deposition date deposition_date	2018-10-29
Structure title title	CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody
Keywords keywords	Alphavirus, EEEV, Eastern Equine Encephalitis Virus, Sindbis, Fab, VIRUS-IMMUNE SYSTEM complex; VIRUS/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	69.54 Å
Radius of gyration Rg (electron density) rg_electron	69.71 Å
Forward intensity I(0) i0	3673450000.00
Molecular weight molecular_weight	504980.0 kDa
Excluded volume excluded_volume	628830 Å³
Envelope volume envelope_volume	1024800 Å³
Hydration-shell volume shell_volume	127160 Å³
Envelope diameter envelope_diameter	252.1 Å
Shell Rg shell_rg	65.63 Å
Envelope Rg envelope_rg	68.16 Å
Shape Rg shape_rg	69.68 Å
Total Rg total_rg	69.72 Å
Total atoms total_atoms	35528
Residues n_residues	4616
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	235.3 Å
Rg (real space) rg_real	69.55 Å
Rg uncertainty (real space) rg_real_error	2.35 Å
I(0) (real space) i0_real	3.6730e+09
I(0) uncertainty (real space) i0_real_error	8.0550e+07
Rg (reciprocal space) rg_reciprocal	69.41 Å
I(0) (reciprocal space) i0_reciprocal	3672000000.0000
Solution quality estimate total_estimate	0.8542
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	81.8 Å
Skewness Skewness skewness	0.316
Kurtosis Kurtosis kurtosis	-0.305
Angular range angular_range	— – 0.1150 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	109500000.0000
Real-space data points n_real_points	24
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.830; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.615

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	E1
Molecular weight formula_weight	47938.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E,I,M
Atom count atom_count	35528

YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITCKYKTKVPSPVVKCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAKAYKVHTGTVQAMVNITYGSVSWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVVYGHEVYNYDFPEYGTGKAGSFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSGFERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSDLECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAESGSFTFHFSTANIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSAFIVLGLIATAVVALVLFFHRH

来源 Source

来源生物 organism	Eastern equine encephalitis virus
通用名 common_name	EEEV
NCBI Class编号 ncbi_taxonomy_id	11021
宿主生物 host_organism	Mesocricetus auratus

Entity 2 Entity 2 polymer

Description description	E2
Molecular weight formula_weight	47047.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F,J,N

DLDTHFTQYKLARPYIADCPNCGHSRCDSPIAIEEVRGDAHAGVIRIQTSAMFGLKTDGVDLAYMSFMNGKTQKSIKIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCTVAHKVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVADHSLLSIHSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAYLIDNKKWVYNSGRLPRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHKHRTLILHLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYTWGNHPPKRVWAQESGEGNPHGWPHEVVVYYYNRYPLTTIIGLCTCVAIIMVSCVTSVWLLCRTRNLCITPYKLAPNAQVPILLALLCCIKPTRA

来源 Source

来源生物 organism	Eastern equine encephalitis virus
通用名 common_name	EEEV
NCBI Class编号 ncbi_taxonomy_id	11021
宿主生物 host_organism	Mesocricetus auratus

Entity 3 Entity 3 polymer

Description description	EEEV-3 antibody heavy chain
Molecular weight formula_weight	23743.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G,K,O

QIQLVQSGREVKNPGETVKISCKASGYTFTEYPMLWVKQAPGKGFRWMGLIYTNTGEPTYAEEFKGRFVFSLEISASTAYLQINNLTNEDTATYFCVRDYFISLDYWGQGTTLTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIESRR

Entity 4 Entity 4 polymer

Description description	EEEV-3 antibody light chain
Molecular weight formula_weight	23177.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H,L,P

QAVVTQESALTTSPGETVTLTCRSNIGAVTSSNCANWVQEKPDHFFTGLIGDTNNRRSGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYNNLWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRADC

▶

8. Citations (1)

▶

Resolution resolution	7.30 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	8416

fit	/app/data/saxs_computation/mw/6mw9/6mw9.fit
pddf	/app/data/pr_computation/mw/6mw9/6mw9.pr.out
profile	/app/data/saxs_computation/mw/6mw9/6mw9.dat

CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1

State in the Current Structure

Other States of the Same Protein in the Database

E2

State in the Current Structure

Other States of the Same Protein in the Database

EEEV-3 antibody light chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)