9yb3

Localized reconstruction of the asymmetric unit of SINV/EEEV.

Method: ELECTRON MICROSCOPY D_max: 203.6 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 glycoprotein

Eastern equine encephalitis virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 4 PDB declaration: 12-meric（12） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain B； UniProt 802–1242 Chain C； UniProt 802–1242 Chain D； UniProt 802–1242	Fragment：UNP residues 802-1242	Capsid protein × 4 （Q88793） E2 glycoprotein × 2 （A9XR09） E2 glycoprotein × 2 （A9XR09） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.60 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YB3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 240	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 72 PDB declaration: 72-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6MX4 CryoEM structure of chimeric Eastern Equine Encephalitis Virus Deposited 2018-10-30	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain D 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain G 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain J 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.40 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 480 PDB declaration: 480-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 40 PDB declaration: 40-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
9YAW Localized reconstruction of the asymmetric unit of SINV/EEEV in complex with Fab EEEV-33 at arm 4 at pH 5.6. Deposited 2025-09-16	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: 14-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain B 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain D 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 5.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9YB4 Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV. Deposited 2025-09-16	Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain B 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain D 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

9 other PDB entries and 37 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	E9KXM2_EEEV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–441； UniProt 802–1242 Author chain B； PDBConstruct 1–441； UniProt 802–1242 Author chain C； PDBConstruct 1–441； UniProt 802–1242 Author chain D； PDBConstruct 1–441； UniProt 802–1242

Capsid protein

Eastern equine encephalitis virus

UniProt Q88793

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 4 PDB declaration: 12-meric（12） Consistent with protein copy count	Chain P； UniProt 102–261 Chain Q； UniProt 102–261 Chain R； UniProt 102–261 Chain S； UniProt 102–261	Fragment：Capsid protein c-terminal domain	E1 glycoprotein × 4 （E9KXM2） E2 glycoprotein × 2 （A9XR09） E2 glycoprotein × 2 （A9XR09） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YB3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YAX Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV in complex with Fab fragment of the antibody EEEV-179 Deposited 2025-09-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: 17-meric	Chain P 102–261（160 aa） Fragment：Capsid protein c-terminal domain Chain Q 102–261（160 aa） Fragment：Capsid protein c-terminal domain Chain R 102–261（160 aa） Fragment：Capsid protein c-terminal domain Chain S 102–261（160 aa） Fragment：Capsid protein c-terminal domain Chain T 102–261（160 aa） Fragment：Capsid protein c-terminal domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9YAZ Localized reconstruction of the asymmetric unit of SINV/EEEV in complex with Fab EEEV-179 at 40C sample. Deposited 2025-09-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: 17-meric	Chain P 102–261（160 aa） Fragment：Capsid c-terminal domain Chain Q 102–261（160 aa） Fragment：Capsid c-terminal domain Chain R 102–261（160 aa） Fragment：Capsid c-terminal domain Chain S 102–261（160 aa） Fragment：Capsid c-terminal domain Chain T 102–261（160 aa） Fragment：Capsid c-terminal domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9YB1 Localized reconstruction of the asymmetric unit of SINV/EEEV at pH 5.6. Deposited 2025-09-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain P 102–261（160 aa） Fragment：Capsid c-terminal domain Chain Q 102–261（160 aa） Fragment：Capsid c-terminal domain Chain R 102–261（160 aa） Fragment：Capsid c-terminal domain Chain S 102–261（160 aa） Fragment：Capsid c-terminal domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 5.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
9YB2 Localized reconstruction of the asymmetric unit of SINV/EEEV at 40C sample. Deposited 2025-09-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain P 102–261（160 aa） Fragment：Capsid c-terminal domain Chain Q 102–261（160 aa） Fragment：Capsid c-terminal domain Chain R 102–261（160 aa） Fragment：Capsid c-terminal domain Chain S 102–261（160 aa） Fragment：Capsid c-terminal domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
9YB4 Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV. Deposited 2025-09-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain P 102–261（160 aa） Fragment：Capsid c-terminal domain Chain Q 102–261（160 aa） Fragment：Capsid c-terminal domain Chain R 102–261（160 aa） Fragment：Capsid c-terminal domain Chain S 102–261（160 aa） Fragment：Capsid c-terminal domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q88793_EEEV
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain P； PDBConstruct 1–160； UniProt 102–261 Author chain Q； PDBConstruct 1–160； UniProt 102–261 Author chain R； PDBConstruct 1–160； UniProt 102–261 Author chain S； PDBConstruct 1–160； UniProt 102–261

E2 glycoprotein

Eastern equine encephalitis virus

UniProt A9XR09

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 4 PDB declaration: 12-meric（12） Consistent with protein copy count	Chain a； UniProt 2–419 Chain b； UniProt 1–419 Chain c； UniProt 1–419 Chain d； UniProt 2–419	Not recorded	E1 glycoprotein × 4 （E9KXM2） Capsid protein × 4 （Q88793） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YB3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8VSV Cryo-EM structure of SINV/EEEV in complex with a potently neutralizing intact human antibody EEEV-373 Deposited 2024-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 16 PDB declaration: 16-meric	Chain a 1–338（338 aa） Chain b 1–338（338 aa） Chain c 1–338（338 aa） Chain d 1–338（338 aa） Chain e 1–338（338 aa） Chain f 1–338（338 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9AY1 Cryo-EM structure of SINV/EEEV in complex with a potently neutralizing human antibody IgG EEEV-373 Deposited 2024-03-07	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 600 PDB declaration: 600-meric	Chain a 1–338（338 aa） Chain b 1–338（338 aa） Chain c 1–338（338 aa） Chain d 1–338（338 aa）	Not recorded	BMA beta-D-mannopyranose × 60 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 240	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
9AY1 Cryo-EM structure of SINV/EEEV in complex with a potently neutralizing human antibody IgG EEEV-373 Deposited 2024-03-07	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain a 1–338（338 aa） Chain b 1–338（338 aa） Chain c 1–338（338 aa） Chain d 1–338（338 aa）	Not recorded	BMA beta-D-mannopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
9AY1 Cryo-EM structure of SINV/EEEV in complex with a potently neutralizing human antibody IgG EEEV-373 Deposited 2024-03-07	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 50 PDB declaration: 50-meric	Chain a 1–338（338 aa） Chain b 1–338（338 aa） Chain c 1–338（338 aa） Chain d 1–338（338 aa）	Not recorded	BMA beta-D-mannopyranose × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
9AY1 Cryo-EM structure of SINV/EEEV in complex with a potently neutralizing human antibody IgG EEEV-373 Deposited 2024-03-07	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 60 PDB declaration: 60-meric	Chain a 1–338（338 aa） Chain b 1–338（338 aa） Chain c 1–338（338 aa） Chain d 1–338（338 aa）	Not recorded	BMA beta-D-mannopyranose × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
9AY1 Cryo-EM structure of SINV/EEEV in complex with a potently neutralizing human antibody IgG EEEV-373 Deposited 2024-03-07	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain a 1–338（338 aa） Chain b 1–338（338 aa） Chain c 1–338（338 aa） Chain d 1–338（338 aa）	Not recorded	BMA beta-D-mannopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
9YAW Localized reconstruction of the asymmetric unit of SINV/EEEV in complex with Fab EEEV-33 at arm 4 at pH 5.6. Deposited 2025-09-16	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: 14-meric	Chain a 2–419（418 aa） Chain b 1–419（419 aa） Chain c 1–419（419 aa） Chain d 2–419（418 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 5.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9YB4 Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV. Deposited 2025-09-16	Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain a 2–419（418 aa） Chain b 1–419（419 aa） Chain c 1–419（419 aa） Chain d 2–419（418 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

4 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A9XR09_EEEV
Isoform	—
PDB entities	3, 4
Chains and sequence ranges	Author chain a； PDBConstruct 1–418； UniProt 2–419 Author chain d； PDBConstruct 1–418； UniProt 2–419 Author chain b； PDBConstruct 1–419； UniProt 1–419 Author chain c； PDBConstruct 1–419； UniProt 1–419

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9yb3
Deposition date deposition_date	2025-09-16
Structure title title	Localized reconstruction of the asymmetric unit of SINV/EEEV.
Keywords keywords	Eastern Equine Encephalitis Virus, Cryo-EM, Single Particle Averaging, localized reconstruction, asymmetric unit., VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	64.40 Å
Radius of gyration Rg (electron density) rg_electron	63.91 Å
Forward intensity I(0) i0	2916920000.00
Molecular weight molecular_weight	452590.0 kDa
Excluded volume excluded_volume	565200 Å³
Envelope volume envelope_volume	951320 Å³
Hydration-shell volume shell_volume	124270 Å³
Envelope diameter envelope_diameter	202.7 Å
Shell Rg shell_rg	66.85 Å
Envelope Rg envelope_rg	60.86 Å
Shape Rg shape_rg	63.85 Å
Total Rg total_rg	64.16 Å
Total atoms total_atoms	31820
Residues n_residues	4078
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	203.6 Å
Rg (real space) rg_real	64.09 Å
Rg uncertainty (real space) rg_real_error	1.69 Å
I(0) (real space) i0_real	2.9170e+09
I(0) uncertainty (real space) i0_real_error	5.9960e+07
Rg (reciprocal space) rg_reciprocal	64.62 Å
I(0) (reciprocal space) i0_reciprocal	2919000000.0000
Solution quality estimate total_estimate	0.8352
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	84.8 Å
Skewness Skewness skewness	0.081
Kurtosis Kurtosis kurtosis	-0.621
Angular range angular_range	— – 0.1200 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	117400000.0000
Real-space data points n_real_points	25
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.960; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.974; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	E1 glycoprotein
Molecular weight formula_weight	47938.1 kDa
EC 编号 ec_number	3.4.21.90
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	31820

YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITCKYKTKVPSPVVKCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAKAYKVHTGTVQAMVNITYGSVSWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVVYGHEVYNYDFPEYGTGKAGSFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSGFERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSDLECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAESGSFTFHFSTANIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSAFIVLGLIATAVVALVLFFHRH

来源 Source

来源生物 organism	Eastern equine encephalitis virus
NCBI Class编号 ncbi_taxonomy_id	11021
宿主生物 host_organism	Mesocricetus auratus

Entity 2 Entity 2 polymer

Description description	Capsid protein
Molecular weight formula_weight	17650.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q,R,S

QRMCMKLESDKTFPIMLNGQVNGYACVVGGRVFKPLHVEGRIDNEQLAAIKLKKASIYDLEYGDVPQCMKSDTLQYTSDKPPGFYNWHHGAVQYENNRFTVPRGVGGKGDSGRPILDNKGRVVAIVLGGVNEGSRTALSVVTWNQKGVTVKDTPEGSEPW

来源 Source

来源生物 organism	Eastern equine encephalitis virus
NCBI Class编号 ncbi_taxonomy_id	11021
宿主生物 host_organism	Mesocricetus auratus

Entity 3 Entity 3 polymer

Description description	E2 glycoprotein
Molecular weight formula_weight	46860.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,d

LDTHFTQYKLARPYIADCPNCGHSRCDSPIAIEEVRGDAHAGVIRIQTSAMFGLKTDGVDLAYMSFMNGKTQKSIKIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCTVAHKVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVADHSLLSIHSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAYLIDNKKWVYNSGRLPRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHKHRTLILHLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYTWGNHPPKRVWAQESGEGNPHGWPHEVVVYYYNRYPLTTIIGLCTCVAIIMVSCVTSVWLLCRTRNLCITPYKLAPNAQVPILLALLCCIKPTR

来源 Source

来源生物 organism	Eastern equine encephalitis virus
NCBI Class编号 ncbi_taxonomy_id	11021
宿主生物 host_organism	Mesocricetus auratus

Entity 4 Entity 4 polymer

Description description	E2 glycoprotein
Molecular weight formula_weight	46975.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,c

DLDTHFTQYKLARPYIADCPNCGHSRCDSPIAIEEVRGDAHAGVIRIQTSAMFGLKTDGVDLAYMSFMNGKTQKSIKIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCTVAHKVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVADHSLLSIHSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAYLIDNKKWVYNSGRLPRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHKHRTLILHLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYTWGNHPPKRVWAQESGEGNPHGWPHEVVVYYYNRYPLTTIIGLCTCVAIIMVSCVTSVWLLCRTRNLCITPYKLAPNAQVPILLALLCCIKPTR

来源 Source

来源生物 organism	Eastern equine encephalitis virus
NCBI Class编号 ncbi_taxonomy_id	11021
宿主生物 host_organism	Mesocricetus auratus

Entity 5 Entity 5 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	4

▶

8. Citations (1)

▶

Resolution resolution	3.600 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.60 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	820454

fit	/app/data/saxs_computation/yb/9yb3/9yb3.fit
pddf	/app/data/pr_computation/yb/9yb3/9yb3.pr.out
profile	/app/data/saxs_computation/yb/9yb3/9yb3.dat

Localized reconstruction of the asymmetric unit of SINV/EEEV.

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

E2 glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Refinement Refinement

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 branched

Entity 6 Entity 6 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)