6mx4

CryoEM structure of chimeric Eastern Equine Encephalitis Virus

Method: ELECTRON MICROSCOPY D_max: 201.4 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1

Eastern equine encephalitis virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 720 其他Polymer 240 PDB declaration: 720-meric（720） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain D； UniProt 802–1242 Chain G； UniProt 802–1242 Chain J； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 240 （E9KXL2） Capsid × 240 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 240 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 240	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
2	Other combination Heteromer Protein × 12 其他Polymer 4 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain D； UniProt 802–1242 Chain G； UniProt 802–1242 Chain J； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 4 （E9KXL2） Capsid × 4 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
3	Other combination Heteromer Protein × 60 其他Polymer 20 PDB declaration: 60-meric（60） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain D； UniProt 802–1242 Chain G； UniProt 802–1242 Chain J； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 20 （E9KXL2） Capsid × 20 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 20 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
4	Other combination Heteromer Protein × 72 其他Polymer 24 PDB declaration: 72-meric（72） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain D； UniProt 802–1242 Chain G； UniProt 802–1242 Chain J； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 24 （E9KXL2） Capsid × 24 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 24 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
5	Other combination Heteromer Protein × 12 其他Polymer 4 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 802–1242 Chain D； UniProt 802–1242 Chain G； UniProt 802–1242 Chain J； UniProt 802–1242	Fragment：ectodomain (UNP residues 802-1242)	E2 × 4 （E9KXL2） Capsid × 4 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6MX4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain E 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain I 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242) Chain M 802–1242（441 aa） Fragment：ectodomain (UNP residues 802-1242)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 480 PDB declaration: 480-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 40 PDB declaration: 40-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain E 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain G 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
9YAW Localized reconstruction of the asymmetric unit of SINV/EEEV in complex with Fab EEEV-33 at arm 4 at pH 5.6. Deposited 2025-09-16	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 14 PDB declaration: 14-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain B 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain D 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 5.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9YB3 Localized reconstruction of the asymmetric unit of SINV/EEEV. Deposited 2025-09-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain B 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain D 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9YB4 Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV. Deposited 2025-09-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain A 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain B 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain C 802–1242（441 aa） Fragment：UNP residues 802-1242 Chain D 802–1242（441 aa） Fragment：UNP residues 802-1242	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

9 other PDB entries and 33 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	E9KXM2_EEEV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–441； UniProt 802–1242 Author chain D； PDBConstruct 1–441； UniProt 802–1242 Author chain G； PDBConstruct 1–441； UniProt 802–1242 Author chain J； PDBConstruct 1–441； UniProt 802–1242

E2

Eastern equine encephalitis virus

UniProt E9KXL2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 720 其他Polymer 240 PDB declaration: 720-meric（720） Consistent with protein copy count	Chain B； UniProt 325–744 Chain E； UniProt 325–744 Chain H； UniProt 325–744 Chain K； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 240 （E9KXM2） Capsid × 240 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 240 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 240	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
2	Other combination Heteromer Protein × 12 其他Polymer 4 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain B； UniProt 325–744 Chain E； UniProt 325–744 Chain H； UniProt 325–744 Chain K； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 4 （E9KXM2） Capsid × 4 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
3	Other combination Heteromer Protein × 60 其他Polymer 20 PDB declaration: 60-meric（60） Consistent with protein copy count	Chain B； UniProt 325–744 Chain E； UniProt 325–744 Chain H； UniProt 325–744 Chain K； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 20 （E9KXM2） Capsid × 20 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 20 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
4	Other combination Heteromer Protein × 72 其他Polymer 24 PDB declaration: 72-meric（72） Consistent with protein copy count	Chain B； UniProt 325–744 Chain E； UniProt 325–744 Chain H； UniProt 325–744 Chain K； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 24 （E9KXM2） Capsid × 24 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 24 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
5	Other combination Heteromer Protein × 12 其他Polymer 4 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain B； UniProt 325–744 Chain E； UniProt 325–744 Chain H； UniProt 325–744 Chain K； UniProt 325–744	Fragment：ectodomain (UNP residues 325-744)	E1 × 4 （E9KXM2） Capsid × 4 （P27284） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6MX4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MUI CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-42 antibody Deposited 2018-10-23	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain F 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain J 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801) Chain N 325–801（477 aa） Fragment：ectodomain (UNP residues 325-801)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.70 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MW9 CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWC CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody Deposited 2018-10-29	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.50 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWV CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.30 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 960 PDB declaration: 960-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6MWX CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-69 Antibody Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain F 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain J 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744) Chain N 325–744（420 aa） Fragment：ectodomain (UNP residues 325-744)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 8.20 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 480 PDB declaration: 480-meric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 40 PDB declaration: 40-meric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 48 PDB declaration: 48-meric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
6ODF EEEV glycoproteins bound with heparan sulfate Deposited 2019-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 325–744（420 aa） Fragment：UNP residues 325-744 Chain D 325–744（420 aa） Fragment：UNP residues 325-744 Chain F 325–744（420 aa） Fragment：UNP residues 325-744 Chain H 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；Tris cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
9YAX Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV in complex with Fab fragment of the antibody EEEV-179 Deposited 2025-09-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: 17-meric	Chain a 325–744（420 aa） Fragment：UNP residues 325-744 Chain b 325–744（420 aa） Fragment：UNP residues 325-744 Chain c 325–744（420 aa） Fragment：UNP residues 325-744 Chain d 325–744（420 aa） Fragment：UNP residues 325-744 Chain e 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9YAZ Localized reconstruction of the asymmetric unit of SINV/EEEV in complex with Fab EEEV-179 at 40C sample. Deposited 2025-09-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 17 PDB declaration: 17-meric	Chain a 325–744（420 aa） Fragment：UNP residues 325-744 Chain b 325–744（420 aa） Fragment：UNP residues 325-744 Chain c 325–744（420 aa） Fragment：UNP residues 325-744 Chain d 325–744（420 aa） Fragment：UNP residues 325-744 Chain e 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9YB1 Localized reconstruction of the asymmetric unit of SINV/EEEV at pH 5.6. Deposited 2025-09-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain a 325–744（420 aa） Fragment：UNP residues 325-744 Chain b 325–744（420 aa） Fragment：UNP residues 325-744 Chain c 325–744（420 aa） Fragment：UNP residues 325-744 Chain d 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 5.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
9YB2 Localized reconstruction of the asymmetric unit of SINV/EEEV at 40C sample. Deposited 2025-09-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: 12-meric	Chain a 325–744（420 aa） Fragment：UNP residues 325-744 Chain b 325–744（420 aa） Fragment：UNP residues 325-744 Chain c 325–744（420 aa） Fragment：UNP residues 325-744 Chain d 325–744（420 aa） Fragment：UNP residues 325-744	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

10 other PDB entries and 34 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	E9KXL2_EEEV
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–420； UniProt 325–744 Author chain E； PDBConstruct 1–420； UniProt 325–744 Author chain H； PDBConstruct 1–420； UniProt 325–744 Author chain K； PDBConstruct 1–420； UniProt 325–744

Capsid

Eastern equine encephalitis virus

UniProt P27284

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 720 其他Polymer 240 PDB declaration: 720-meric（720） Consistent with protein copy count	Chain C； UniProt 1–260 Chain F； UniProt 1–260 Chain I； UniProt 1–260 Chain L； UniProt 1–260	Fragment：N-terminal domain (UNP residues 1-260)	E1 × 240 （E9KXM2） E2 × 240 （E9KXL2） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 240 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 240	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
2	Other combination Heteromer Protein × 12 其他Polymer 4 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain C； UniProt 1–260 Chain F； UniProt 1–260 Chain I； UniProt 1–260 Chain L； UniProt 1–260	Fragment：N-terminal domain (UNP residues 1-260)	E1 × 4 （E9KXM2） E2 × 4 （E9KXL2） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
3	Other combination Heteromer Protein × 60 其他Polymer 20 PDB declaration: 60-meric（60） Consistent with protein copy count	Chain C； UniProt 1–260 Chain F； UniProt 1–260 Chain I； UniProt 1–260 Chain L； UniProt 1–260	Fragment：N-terminal domain (UNP residues 1-260)	E1 × 20 （E9KXM2） E2 × 20 （E9KXL2） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 20 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
4	Other combination Heteromer Protein × 72 其他Polymer 24 PDB declaration: 72-meric（72） Consistent with protein copy count	Chain C； UniProt 1–260 Chain F； UniProt 1–260 Chain I； UniProt 1–260 Chain L； UniProt 1–260	Fragment：N-terminal domain (UNP residues 1-260)	E1 × 24 （E9KXM2） E2 × 24 （E9KXL2） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 24 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 24	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å
5	Other combination Heteromer Protein × 12 其他Polymer 4 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain C； UniProt 1–260 Chain F； UniProt 1–260 Chain I； UniProt 1–260 Chain L； UniProt 1–260	Fragment：N-terminal domain (UNP residues 1-260)	E1 × 4 （E9KXM2） E2 × 4 （E9KXL2） ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen HELIUM	Resolution 4.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6MX4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6MX7 CryoEM structure of chimeric Eastern Equine Encephalitis Virus: Genome-Binding Capsid N-terminal Domain Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain C 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain F 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain I 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain L 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.80 Å
6MX7 CryoEM structure of chimeric Eastern Equine Encephalitis Virus: Genome-Binding Capsid N-terminal Domain Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain F 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain I 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain L 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.80 Å
6MX7 CryoEM structure of chimeric Eastern Equine Encephalitis Virus: Genome-Binding Capsid N-terminal Domain Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain C 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain F 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain I 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain L 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.80 Å
6MX7 CryoEM structure of chimeric Eastern Equine Encephalitis Virus: Genome-Binding Capsid N-terminal Domain Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain C 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain F 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain I 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain L 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.80 Å
6MX7 CryoEM structure of chimeric Eastern Equine Encephalitis Virus: Genome-Binding Capsid N-terminal Domain Deposited 2018-10-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain F 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain I 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260) Chain L 1–260（260 aa） Fragment：N-terminal domain (UNP residues 1-260)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen HELIUM	Resolution 4.80 Å

1 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLS_EEEV3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–260； UniProt 1–260 Author chain F； PDBConstruct 1–260； UniProt 1–260 Author chain I； PDBConstruct 1–260； UniProt 1–260 Author chain L； PDBConstruct 1–260； UniProt 1–260

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6mx4
Deposition date deposition_date	2018-10-30
Structure title title	CryoEM structure of chimeric Eastern Equine Encephalitis Virus
Keywords keywords	Alphavirus, EEEV, Eastern Equine Encephalitis Virus, Sindbis, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	63.13 Å
Radius of gyration Rg (electron density) rg_electron	62.67 Å
Forward intensity I(0) i0	2853240000.00
Molecular weight molecular_weight	447940.0 kDa
Excluded volume excluded_volume	559570 Å³
Envelope volume envelope_volume	934170 Å³
Hydration-shell volume shell_volume	124090 Å³
Envelope diameter envelope_diameter	202.9 Å
Shell Rg shell_rg	66.20 Å
Envelope Rg envelope_rg	59.86 Å
Shape Rg shape_rg	62.61 Å
Total Rg total_rg	62.94 Å
Total atoms total_atoms	31491
Residues n_residues	4039
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	201.4 Å
Rg (real space) rg_real	62.85 Å
Rg uncertainty (real space) rg_real_error	1.67 Å
I(0) (real space) i0_real	2.8530e+09
I(0) uncertainty (real space) i0_real_error	5.7590e+07
Rg (reciprocal space) rg_reciprocal	63.32 Å
I(0) (reciprocal space) i0_reciprocal	2855000000.0000
Solution quality estimate total_estimate	0.8337
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	80.6 Å
Skewness Skewness skewness	0.092
Kurtosis Kurtosis kurtosis	-0.619
Angular range angular_range	— – 0.1250 Å⁻¹
Current regularization parameter α current_alpha	0.0002
Highest regularization parameter α highest_alpha	118100000.0000
Real-space data points n_real_points	26
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.953; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.974; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	E1
Molecular weight formula_weight	47938.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J
Atom count atom_count	31491

YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITCKYKTKVPSPVVKCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAKAYKVHTGTVQAMVNITYGSVSWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVVYGHEVYNYDFPEYGTGKAGSFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSGFERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSDLECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAESGSFTFHFSTANIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSAFIVLGLIATAVVALVLFFHRH

来源 Source

来源生物 organism	Eastern equine encephalitis virus
通用名 common_name	EEEV
NCBI Class编号 ncbi_taxonomy_id	11021
宿主生物 host_organism	Mesocricetus auratus

Entity 2 Entity 2 polymer

Description description	E2
Molecular weight formula_weight	47047.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K

DLDTHFTQYKLARPYIADCPNCGHSRCDSPIAIEEVRGDAHAGVIRIQTSAMFGLKTDGVDLAYMSFMNGKTQKSIKIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCTVAHKVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVADHSLLSIHSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAYLIDNKKWVYNSGRLPRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHKHRTLILHLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYTWGNHPPKRVWAQESGEGNPHGWPHEVVVYYYNRYPLTTIIGLCTCVAIIMVSCVTSVWLLCRTRNLCITPYKLAPNAQVPILLALLCCIKPTRA

来源 Source

来源生物 organism	Eastern equine encephalitis virus
通用名 common_name	EEEV
NCBI Class编号 ncbi_taxonomy_id	11021
宿主生物 host_organism	Mesocricetus auratus

Entity 3 Entity 3 polymer

Description description	Capsid
Molecular weight formula_weight	28861.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L

MFPYPTLNYPPMAPINPMAYRDPNPPRQVAPFRPPLAAQIEDLRRSIANLTLKQRAPNPPAGPPAKRKKPAPKPKPAQAKKKRPPPPAKKQKRKPKPGKRQRMCMKLESDKTFPIMLNGQVNGYACVVGGRVFKPLHVEGRIDNEQLAAIKLKKASIYDLEYGDVPQCMKSDTLQYTSDKPPGFYNWHHGAVQYENNRFTVPRGVGGKGDSGRPILDNKGRVVAIVLGGVNEGSRTALSVVTWNQKGVTVKDTPEGSEPW

来源 Source

来源生物 organism	Eastern equine encephalitis virus
通用名 common_name	EEEV
NCBI Class编号 ncbi_taxonomy_id	11021
宿主生物 host_organism	Mesocricetus auratus

Entity 4 Entity 4 branched

Description description	;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	627.6 kDa
Source method src_method	man
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	4

▶

8. Citations (1)

▶

Resolution resolution	4.40 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	30806

fit	/app/data/saxs_computation/mx/6mx4/6mx4.fit
pddf	/app/data/pr_computation/mx/6mx4/6mx4.pr.out
profile	/app/data/saxs_computation/mx/6mx4/6mx4.dat

CryoEM structure of chimeric Eastern Equine Encephalitis Virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1

State in the Current Structure

Other States of the Same Protein in the Database

E2

State in the Current Structure

Other States of the Same Protein in the Database

Capsid

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)