SAXSdb — 8epa

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytokine receptor common subunit gamma

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 5 其他Polymer 1 PDB declaration: pentameric（5） Consistent with protein copy count	Chain I； UniProt 23–262	Not recorded	REGN7257 Fab heavy chain × 1 REGN7257 Fab light chain × 1 REGN9432 Fab heavy chain × 1 REGN9432 Fab light chain × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8EPA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2B5I cytokine receptor complex Deposited 2005-09-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 56–254（199 aa）	Mutation：N53Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；293 K；29% Pentaerythritol Ethoxylate 15/4; 50 mM Ammonium Sulfate; 50 mM Bis Tris, pH 6.1, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.30 Å R-free 0.269
2ERJ Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2 Deposited 2005-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 23–255（233 aa）	Mutation：N58Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.1；295.5 K；MPEG 550, sodium acetate, sodium citrate, phenol, pH 5.1, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 3.00 Å R-free 0.263
2ERJ Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2 Deposited 2005-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 23–255（233 aa）	Mutation：N58Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.1；295.5 K；MPEG 550, sodium acetate, sodium citrate, phenol, pH 5.1, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 3.00 Å R-free 0.263
3BPL Crystal structure of the IL4-IL4R-Common Gamma ternary complex Deposited 2007-12-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 56–254（199 aa） Fragment：Extracellular domain, residues 56-254	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；10% PEG8K, 8% ethylene glycol, 0.1M HEPES pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.93 Å R-free 0.297
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain d 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain g 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 12 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain j 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain O 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain R 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain U 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain X 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain a 56–254（199 aa） Fragment：unp residues 56-254	Mutation：N75Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QB7 Interleukin-4 mutant RGA bound to cytokine receptor common gamma Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 55–254（200 aa） Fragment：UNP residues 55-254	Mutation：N53Q	SO4 SULFATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.3；298 K；100 mM (NH4)2SO4, 100 mM Cacodylate, 20% PEG-3350, pH 6.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.25 Å R-free 0.292
3QB7 Interleukin-4 mutant RGA bound to cytokine receptor common gamma Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 55–254（200 aa） Fragment：UNP residues 55-254	Mutation：N53Q	SO4 SULFATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.3；298 K；100 mM (NH4)2SO4, 100 mM Cacodylate, 20% PEG-3350, pH 6.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.25 Å R-free 0.292
4GS7 Structure of the Interleukin-15 quaternary complex Deposited 2012-08-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 55–254（200 aa）	Mutation：N75Q Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 1 ACT ACETATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.75；298 K；22.5% PEG3350, 0.1M BIS-TRIS propane, 0.2M sodium acetate, pH 8.75, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.35 Å R-free 0.227
5M5E Crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor Deposited 2016-10-21	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 23–262（240 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4 CYS CYSTEINE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.1M HEPES, pH 7.0, 2M ammonium sulfate	Resolution 2.30 Å R-free 0.235
6OEL Engineered Fab bound to IL-4 receptor Deposited 2019-03-27	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 61–249（189 aa） Fragment：UNP residues 61-249	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；295 K；22.5% PurePEG (Microlytic), 0.1 M sodium citrate, pH 5.5, 0.6 M ammonium nitrate	Resolution 3.10 Å R-free 0.256
7S2R nanobody bound to IL-2Rg Deposited 2021-09-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 55–254（200 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 SO4 SULFATE ION × 8 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；295 K；2M ammonium sulfate, 0.2M BIS-Tris pH5.5	Resolution 2.49 Å R-free 0.271
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 55–254（200 aa）	Mutation：N53Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 55–254（200 aa）	Mutation：N53Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 55–254（200 aa）	Mutation：N53Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 55–254（200 aa） Fragment：residues 55-254	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 55–254（200 aa） Fragment：residues 55-254	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9JQT Structure of interleukin receptor common gamma chain (IL2Rgamma/CD132) in complex with 2D4 Deposited 2024-09-28	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 23–262（240 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9KMC Cryo-EM structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2 and anti-CD25 Fab S417 Deposited 2024-11-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 23–255（233 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å

13 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL2RG_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain I； PDBConstruct 1–240； UniProt 23–262

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8epa
Deposition date deposition_date	2022-10-05
Structure title title	Structure of interleukin receptor common gamma chain (IL2Rgamma) in complex with two antibodies
Keywords keywords	interleukin signaling, lymphocyte maturation, blocking antibody, immunoglobulin, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	33.99 Å
Radius of gyration Rg (electron density) rg_electron	33.95 Å
Forward intensity I(0) i0	84177000.00
Molecular weight molecular_weight	71578.0 kDa
Excluded volume excluded_volume	88829 Å³
Envelope volume envelope_volume	119360 Å³
Hydration-shell volume shell_volume	30763 Å³
Envelope diameter envelope_diameter	124.4 Å
Shell Rg shell_rg	38.45 Å
Envelope Rg envelope_rg	33.58 Å
Shape Rg shape_rg	33.89 Å
Total Rg total_rg	34.50 Å
Total atoms total_atoms	5045
Residues n_residues	637
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	117.2 Å
Rg (real space) rg_real	34.24 Å
Rg uncertainty (real space) rg_real_error	1.35 Å
I(0) (real space) i0_real	8.4180e+07
I(0) uncertainty (real space) i0_real_error	1.4700e+06
Rg (reciprocal space) rg_reciprocal	34.09 Å
I(0) (reciprocal space) i0_reciprocal	84170000.0000
Solution quality estimate total_estimate	0.7687
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	32.4 Å
Skewness Skewness skewness	0.478
Kurtosis Kurtosis kurtosis	-0.406
Angular range angular_range	— – 0.2350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	10240000.0000
Real-space data points n_real_points	48
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.785; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.637; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Cytokine receptor common subunit gamma
Molecular weight formula_weight	31617.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I
Atom count atom_count	5045

LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAEQKLISEEDLGGEQKLISEEDLHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Cricetulus griseus

Entity 2 Entity 2 polymer

Description description	REGN7257 Fab heavy chain
Molecular weight formula_weight	23607.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

EVQLVESGGGLVQPGGSLRLSCAASGFIFSSYEMHWVRQAPGKGLEWISYISSSGTTIYYADSVKGRFTISRDNAKNSLYLHMNSLRAEDTAVYYCTRARITGTFDVFDIWGQGTMVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE

来源 Source

来源生物 organism	Mus musculus
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Cricetulus griseus

Entity 3 Entity 3 polymer

Description description	REGN7257 Fab light chain
Molecular weight formula_weight	23541.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIFAASNLQSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQNYNIPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

来源 Source

来源生物 organism	Mus musculus
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Cricetulus griseus

Entity 4 Entity 4 polymer

Description description	REGN9432 Fab heavy chain
Molecular weight formula_weight	23323.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

EVQLVESGGGVVRPGGSLRLSCAASGFTFDDFDMSWVRQGPGKGLEWVSGINWHGSSTGYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTALYHCVRGGTIVGATTPLDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE

来源 Source

来源生物 organism	Mus musculus
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Cricetulus griseus

Entity 5 Entity 5 polymer

Description description	REGN9432 Fab light chain
Molecular weight formula_weight	23247.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

DIQMTQSPSSLSASVGDRVTMTCRASRTISSYLSWYQQKSGKVPNLLIFGASSLQSGVPSRFSASGSGTDFTLIISSLQPEDFATYYCQQSYSSPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

来源 Source

来源生物 organism	Mus musculus
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Cricetulus griseus

Entity 6 Entity 6 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	1

▼

7. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	8epaA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	8epaH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	8epaL01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.40 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	435563

fit	/app/data/saxs_computation/ep/8epa/8epa.fit
pddf	/app/data/pr_computation/ep/8epa/8epa.pr.out
profile	/app/data/saxs_computation/ep/8epa/8epa.dat

Structure of interleukin receptor common gamma chain (IL2Rgamma) in complex with two antibodies

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytokine receptor common subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 branched

7. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)