SAXSdb — 8ewf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 envelope protein

Chikungunya virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Spike glycoprotein E2 × 4 （Q5XXP3） Chimeric MXRA8 receptor: D1 from Duck MXRA8 and D2 from Mouse MXRA8 × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1I7PD18_CHIKV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–439； UniProt 810–1248 Author chain G； PDBConstruct 1–439； UniProt 810–1248 Author chain K； PDBConstruct 1–439； UniProt 810–1248 Author chain O； PDBConstruct 1–439； UniProt 810–1248

Spike glycoprotein E2

Chikungunya virus

UniProt Q5XXP3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	E1 envelope protein × 4 （A0A1I7PD18） Chimeric MXRA8 receptor: D1 from Duck MXRA8 and D2 from Mouse MXRA8 × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLS_CHIK3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–419； UniProt 330–748 Author chain I； PDBConstruct 1–419； UniProt 330–748 Author chain M； PDBConstruct 1–419； UniProt 330–748 Author chain Q； PDBConstruct 1–419； UniProt 330–748

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ewf
Deposition date deposition_date	2022-10-22
Structure title title	CryoEM structure of Western equine encephalitis virus VLP in complex with the avian MXRA8 receptor
Keywords keywords	;WEEV, MXRA8, Receptor, Alphavirus, Avian, VLP, Structural Genomics, PSI-2, Protein Structure Initiative, Center for Structural Genomics of Infectious Diseases, CSGID, VIRUS LIKE PARTICLE, VIRAL PROTEIN ;; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ewf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ewf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ewf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.91 Å
Rg (electron density)	59.78 Å
Total Rg	60.18 Å
Atom count	56651
Residues	3697
Excluded volume	508130 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ewf__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	E1 envelope protein
Molecular weight formula_weight	47346.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,G,K,O
Atom count atom_count	56651

YEHVTVIPNTVGVPYKTLVNRPGYSPMVLEMELQSVTLEPTLSLDYITCEYKTVIPSPYVKCCGTAECKDKSLPDYSCKVFTGVYPFMWGGAYCFCDAENTQLSEAHVEKSESCKTEFASAYRAHTASASAKLRVLYQGNNITVAAYANGDHAVTVKDAKFVVGPMSSAWTPFDNKIVVYKGDVYNMDYPPFGAGRPGQFGDIQSRTPESKDVYANTQLVLQRPAAGTVHVPYSQAPSGFKYWLKERGASLQHTAPFGCQIATNPVRAVNCAVGNIPISIDIPDAAFTRVVDAPSVTDMSCEVPACTHSSDFGGVAIIKYTASKKGKCAVHSMTNAVTIREADVEVEGNSQLQISFSTALASAEFRVQVCSTQVHCAAACHPPKDHIVNYPASHTTLGVQDISTTAMSWVQKITGGVGLIVAVAALILIVVLCVSFSRH

Source Source

Source organism organism	Chikungunya virus
NCBI taxonomy ID ncbi_taxonomy_id	37124
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Spike glycoprotein E2
Molecular weight formula_weight	46858.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,I,M,Q

NFNVYKATRPYLAHCPDCGEGHSCHSPIALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDSHTPADAERAGLLVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHTCTHPFHHEPPVIGRERFHSRPQHGKELPCSTYVQSTAATAEEIEVHMPPDTPDRTLMTQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKIDQCHAAVTNHKNWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVTMLLYPDHPTLLSYRNMGQEPNYHEEWVTHKKEVTLTVPTEGLEVTWGNNEPYKYWPQMSTNGTAHGHPHEIILYYYELYPTMTVVIVSVASFVLLSMVGTAVGMCVCARRRCITPYELTPGATVPFLLSLLCCVRTTKA

Source Source

Source organism organism	Chikungunya virus
NCBI taxonomy ID ncbi_taxonomy_id	37124
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Chimeric MXRA8 receptor: D1 from Duck MXRA8 and D2 from Mouse MXRA8
Molecular weight formula_weight	30539.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

SSSLVSESVVSLAAGTQAVLRCQSPRMVWTQDRLNDRQRVVHWDVYSTYYGDNKMERLCDMYSAGDQRVYSSYNQGRIFMPQNAFTDGNFSLVIKDVAESDGGIYSCNLHHHYCHLYETVKIQLDVTKKAKAAKEYWDGEKAVIVALEGSTVMLPCVNRNQIWTERHLEEAQQVVHWDRQLPGVSHDRADRLLDLYASGERRAYGPPFLRDRVSVNTNAFARGDFSLRIDELERADEGIYSCHLHHHYCGLHERRVFHLQVTEPA

Source Source

Source organism organism	Anas platyrhynchos
NCBI taxonomy ID ncbi_taxonomy_id	8839
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	9

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.92 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	745448

CryoEM structure of Western equine encephalitis virus VLP in complex with the avian MXRA8 receptor

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 envelope protein

State in the Current Structure

Other States of the Same Protein in the Database

Spike glycoprotein E2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ewf__assembly_1__model_1

8ewf__assembly_1__model_1 | I(q)

8ewf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)

CryoEM structure of Western equine encephalitis virus VLP in complex with the avian MXRA8 receptor

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 envelope protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Spike glycoprotein E2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ewf__assembly_1__model_1

8ewf__assembly_1__model_1 | I(q)

8ewf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)