SAXSdb — 8jc9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

LH1 alpha polypeptide

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	LH1 beta polypeptide × 14 （D2Z0P1） BACTERIOCHLOROPHYLL A × 28 CALCIUM ION × 14 SPIRILLOXANTHIN × 14 DODECANE × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P2_THETI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–61； UniProt 1–61 Author chain 3； PDBConstruct 1–61； UniProt 1–61 Author chain 5； PDBConstruct 1–61； UniProt 1–61 Author chain 7； PDBConstruct 1–61； UniProt 1–61 Author chain A； PDBConstruct 1–61； UniProt 1–61 Author chain D； PDBConstruct 1–61； UniProt 1–61 Author chain F； PDBConstruct 1–61； UniProt 1–61 Author chain I； PDBConstruct 1–61； UniProt 1–61 Author chain K； PDBConstruct 1–61； UniProt 1–61 Author chain O； PDBConstruct 1–61； UniProt 1–61 Author chain Q； PDBConstruct 1–61； UniProt 1–61 Author chain S； PDBConstruct 1–61； UniProt 1–61 Author chain U； PDBConstruct 1–61； UniProt 1–61 Author chain Y； PDBConstruct 1–61； UniProt 1–61

LH1 beta polypeptide

OrganismNot specified

UniProt D2Z0P1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	LH1 alpha polypeptide × 14 （D2Z0P2） BACTERIOCHLOROPHYLL A × 28 CALCIUM ION × 14 SPIRILLOXANTHIN × 14 DODECANE × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P1_THETI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–47； UniProt 1–47 Author chain 4； PDBConstruct 1–47； UniProt 1–47 Author chain 6； PDBConstruct 1–47； UniProt 1–47 Author chain 8； PDBConstruct 1–47； UniProt 1–47 Author chain B； PDBConstruct 1–47； UniProt 1–47 Author chain E； PDBConstruct 1–47； UniProt 1–47 Author chain G； PDBConstruct 1–47； UniProt 1–47 Author chain J； PDBConstruct 1–47； UniProt 1–47 Author chain N； PDBConstruct 1–47； UniProt 1–47 Author chain P； PDBConstruct 1–47； UniProt 1–47 Author chain R； PDBConstruct 1–47； UniProt 1–47 Author chain T； PDBConstruct 1–47； UniProt 1–47 Author chain V； PDBConstruct 1–47； UniProt 1–47 Author chain Z； PDBConstruct 1–47； UniProt 1–47

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8jc9
Deposition date deposition_date	2023-05-10
Last revision last_revision	2024-11-13
Structure title title	Cryo-EM structure of the LH1 complex from thermochromatium tepidum
Keywords keywords	LH1 COMPLEX, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8jc9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8jc9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8jc9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.52 Å
Rg (electron density)	44.25 Å
Total Rg	44.87 Å
Atom count	13411
Residues	1307
Excluded volume	255000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8jc9__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	LH1 alpha polypeptide
Molecular weight formula_weight	7034.4 kDa
Source method src_method	nat
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,3,5,7,A,D,F,I,K,O,Q,S,U,Y
Atom count atom_count	13411

MFTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIPVSYQALGKK

Entity 2 Entity 2 polymer

Description description	LH1 beta polypeptide
Molecular weight formula_weight	5534.5 kDa
Source method src_method	nat
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,4,6,8,B,E,G,J,N,P,R,T,V,Z

MAEQKSLTGLTDDEAKEFHAIFMQSMYAWFGLVVIAHLLAWLYRPWL

Entity 3 Entity 3 non-polymer

Description description	BACTERIOCHLOROPHYLL A
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 5 Entity 5 non-polymer

Description description	SPIRILLOXANTHIN
Molecular weight formula_weight	596.9 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 6 Entity 6 non-polymer

Description description	DODECANE
Molecular weight formula_weight	170.3 kDa
Source method src_method	syn
Copy count entity_count	14

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.32 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	47987

Cryo-EM structure of the LH1 complex from thermochromatium tepidum

1. Protein Identity and Related Structures Protein Identity & Related Structures

LH1 alpha polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

LH1 beta polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8jc9__assembly_1__model_1

8jc9__assembly_1__model_1 | I(q)

8jc9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

Cryo-EM structure of the LH1 complex from thermochromatium tepidum

1. Protein Identity and Related Structures Protein Identity & Related Structures

LH1 alpha polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LH1 beta polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8jc9__assembly_1__model_1

8jc9__assembly_1__model_1 | I(q)

8jc9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)