8otz

48-nm repeat of the native axonemal doublet microtubule from bovine sperm

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cilia- and flagella-associated protein 95

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA95_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–232； UniProt 1–232 Author chain V； PDBConstruct 1–232； UniProt 1–232

Sperm acrosome associated 9

OrganismNot specified

UniProt A0A3Q1MYU9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1MYU9_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 0A； PDBConstruct 1–224； UniProt 1–224 Author chain 0C； PDBConstruct 1–224； UniProt 1–224 Author chain 0E； PDBConstruct 1–224； UniProt 1–224 Author chain 0G； PDBConstruct 1–224； UniProt 1–224 Author chain 0W； PDBConstruct 1–224； UniProt 1–224 Author chain 0Y； PDBConstruct 1–224； UniProt 1–224 Author chain 0a； PDBConstruct 1–224； UniProt 1–224 Author chain 0c； PDBConstruct 1–224； UniProt 1–224 Author chain 0e； PDBConstruct 1–224； UniProt 1–224 Author chain 0g； PDBConstruct 1–224； UniProt 1–224 Author chain 0i； PDBConstruct 1–224； UniProt 1–224 Author chain 0k； PDBConstruct 1–224； UniProt 1–224 Author chain CT； PDBConstruct 1–224； UniProt 1–224 Author chain CU； PDBConstruct 1–224； UniProt 1–224 Author chain CV； PDBConstruct 1–224； UniProt 1–224 Author chain CX； PDBConstruct 1–224； UniProt 1–224 Author chain CY； PDBConstruct 1–224； UniProt 1–224 Author chain CZ； PDBConstruct 1–224； UniProt 1–224 Author chain Ca； PDBConstruct 1–224； UniProt 1–224 Author chain Cb； PDBConstruct 1–224； UniProt 1–224 Author chain Cc； PDBConstruct 1–224； UniProt 1–224 Author chain Cd； PDBConstruct 1–224； UniProt 1–224 Author chain Ce； PDBConstruct 1–224； UniProt 1–224 Author chain Cf； PDBConstruct 1–224； UniProt 1–224 Author chain Cg； PDBConstruct 1–224； UniProt 1–224 Author chain Ch； PDBConstruct 1–224； UniProt 1–224 Author chain Ci； PDBConstruct 1–224； UniProt 1–224 Author chain Cj； PDBConstruct 1–224； UniProt 1–224 Author chain Ck； PDBConstruct 1–224； UniProt 1–224

Testis specific serine kinase 6

OrganismNot specified

UniProt F1N2S7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1N2S7_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 1； PDBConstruct 1–273； UniProt 1–273 Author chain 2； PDBConstruct 1–273； UniProt 1–273 Author chain x； PDBConstruct 1–273； UniProt 1–273

EF-hand domain-containing protein

OrganismNot specified

UniProt G5E5A3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G5E5A3_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 3； PDBConstruct 1–275； UniProt 1–275 Author chain y； PDBConstruct 1–275； UniProt 1–275 Author chain z； PDBConstruct 1–275； UniProt 1–275

ATP6V1F neighbor

OrganismNot specified

UniProt G3X8G1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G3X8G1_BOVIN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–176； UniProt 1–176 Author chain B； PDBConstruct 1–176； UniProt 1–176 Author chain C； PDBConstruct 1–176； UniProt 1–176

Outer dense fiber of sperm tails 3

OrganismNot specified

UniProt G3X6A7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G3X6A7_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A1； PDBConstruct 1–254； UniProt 1–254 Author chain A2； PDBConstruct 1–254； UniProt 1–254 Author chain A3； PDBConstruct 1–254； UniProt 1–254 Author chain A4； PDBConstruct 1–254； UniProt 1–254 Author chain A5； PDBConstruct 1–254； UniProt 1–254 Author chain A6； PDBConstruct 1–254； UniProt 1–254 Author chain A7； PDBConstruct 1–254； UniProt 1–254 Author chain A8； PDBConstruct 1–254； UniProt 1–254 Author chain A9； PDBConstruct 1–254； UniProt 1–254 Author chain Au； PDBConstruct 1–254； UniProt 1–254 Author chain Av； PDBConstruct 1–254； UniProt 1–254 Author chain Aw； PDBConstruct 1–254； UniProt 1–254 Author chain Ay； PDBConstruct 1–254； UniProt 1–254 Author chain Az； PDBConstruct 1–254； UniProt 1–254

Tubulin alpha-3 chain

OrganismNot specified

UniProt Q32KN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA3_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AA； PDBConstruct 1–450； UniProt 1–450 Author chain AC； PDBConstruct 1–450； UniProt 1–450 Author chain AE； PDBConstruct 1–450； UniProt 1–450 Author chain AG； PDBConstruct 1–450； UniProt 1–450 Author chain AI； PDBConstruct 1–450； UniProt 1–450 Author chain AK； PDBConstruct 1–450； UniProt 1–450 Author chain AM； PDBConstruct 1–450； UniProt 1–450 Author chain BA； PDBConstruct 1–450； UniProt 1–450 Author chain BC； PDBConstruct 1–450； UniProt 1–450 Author chain BE； PDBConstruct 1–450； UniProt 1–450 Author chain BG； PDBConstruct 1–450； UniProt 1–450 Author chain BI； PDBConstruct 1–450； UniProt 1–450 Author chain BK； PDBConstruct 1–450； UniProt 1–450 Author chain BM； PDBConstruct 1–450； UniProt 1–450 Author chain CA； PDBConstruct 1–450； UniProt 1–450 Author chain CC； PDBConstruct 1–450； UniProt 1–450 Author chain CE； PDBConstruct 1–450； UniProt 1–450 Author chain CG； PDBConstruct 1–450； UniProt 1–450 Author chain CI； PDBConstruct 1–450； UniProt 1–450 Author chain CK； PDBConstruct 1–450； UniProt 1–450 Author chain CM； PDBConstruct 1–450； UniProt 1–450 Author chain DA； PDBConstruct 1–450； UniProt 1–450 Author chain DC； PDBConstruct 1–450； UniProt 1–450 Author chain DE； PDBConstruct 1–450； UniProt 1–450 Author chain DG； PDBConstruct 1–450； UniProt 1–450 Author chain DI； PDBConstruct 1–450； UniProt 1–450 Author chain DK； PDBConstruct 1–450； UniProt 1–450 Author chain DM； PDBConstruct 1–450； UniProt 1–450 Author chain EC； PDBConstruct 1–450； UniProt 1–450 Author chain EE； PDBConstruct 1–450； UniProt 1–450 Author chain EG； PDBConstruct 1–450； UniProt 1–450 Author chain EI； PDBConstruct 1–450； UniProt 1–450 Author chain EK； PDBConstruct 1–450； UniProt 1–450 Author chain EM； PDBConstruct 1–450； UniProt 1–450 Author chain FC； PDBConstruct 1–450； UniProt 1–450 Author chain FE； PDBConstruct 1–450； UniProt 1–450 Author chain FG； PDBConstruct 1–450； UniProt 1–450 Author chain FI； PDBConstruct 1–450； UniProt 1–450 Author chain FK； PDBConstruct 1–450； UniProt 1–450 Author chain FM； PDBConstruct 1–450； UniProt 1–450 Author chain GC； PDBConstruct 1–450； UniProt 1–450 Author chain GE； PDBConstruct 1–450； UniProt 1–450 Author chain GG； PDBConstruct 1–450； UniProt 1–450 Author chain GI； PDBConstruct 1–450； UniProt 1–450 Author chain GK； PDBConstruct 1–450； UniProt 1–450 Author chain GM； PDBConstruct 1–450； UniProt 1–450 Author chain HC； PDBConstruct 1–450； UniProt 1–450 Author chain HE； PDBConstruct 1–450； UniProt 1–450 Author chain HG； PDBConstruct 1–450； UniProt 1–450 Author chain HI； PDBConstruct 1–450； UniProt 1–450 Author chain HK； PDBConstruct 1–450； UniProt 1–450 Author chain HM； PDBConstruct 1–450； UniProt 1–450 Author chain HO； PDBConstruct 1–450； UniProt 1–450 Author chain IC； PDBConstruct 1–450； UniProt 1–450 Author chain IE； PDBConstruct 1–450； UniProt 1–450 Author chain IG； PDBConstruct 1–450； UniProt 1–450 Author chain II； PDBConstruct 1–450； UniProt 1–450 Author chain IK； PDBConstruct 1–450； UniProt 1–450 Author chain IM； PDBConstruct 1–450； UniProt 1–450 Author chain IO； PDBConstruct 1–450； UniProt 1–450 Author chain JC； PDBConstruct 1–450； UniProt 1–450 Author chain JE； PDBConstruct 1–450； UniProt 1–450 Author chain JG； PDBConstruct 1–450； UniProt 1–450 Author chain JI； PDBConstruct 1–450； UniProt 1–450 Author chain JK； PDBConstruct 1–450； UniProt 1–450 Author chain JM； PDBConstruct 1–450； UniProt 1–450 Author chain KC； PDBConstruct 1–450； UniProt 1–450 Author chain KE； PDBConstruct 1–450； UniProt 1–450 Author chain KG； PDBConstruct 1–450； UniProt 1–450 Author chain KI； PDBConstruct 1–450； UniProt 1–450 Author chain KK； PDBConstruct 1–450； UniProt 1–450 Author chain KM； PDBConstruct 1–450； UniProt 1–450 Author chain KO； PDBConstruct 1–450； UniProt 1–450 Author chain LC； PDBConstruct 1–450； UniProt 1–450 Author chain LE； PDBConstruct 1–450； UniProt 1–450 Author chain LG； PDBConstruct 1–450； UniProt 1–450 Author chain LI； PDBConstruct 1–450； UniProt 1–450 Author chain LK； PDBConstruct 1–450； UniProt 1–450 Author chain LM； PDBConstruct 1–450； UniProt 1–450 Author chain MC； PDBConstruct 1–450； UniProt 1–450 Author chain ME； PDBConstruct 1–450； UniProt 1–450 Author chain MG； PDBConstruct 1–450； UniProt 1–450 Author chain MI； PDBConstruct 1–450； UniProt 1–450 Author chain MK； PDBConstruct 1–450； UniProt 1–450 Author chain MM； PDBConstruct 1–450； UniProt 1–450 Author chain NA； PDBConstruct 1–450； UniProt 1–450 Author chain NC； PDBConstruct 1–450； UniProt 1–450 Author chain NE； PDBConstruct 1–450； UniProt 1–450 Author chain NG； PDBConstruct 1–450； UniProt 1–450 Author chain NI； PDBConstruct 1–450； UniProt 1–450 Author chain NK； PDBConstruct 1–450； UniProt 1–450 Author chain OA； PDBConstruct 1–450； UniProt 1–450 Author chain OC； PDBConstruct 1–450； UniProt 1–450 Author chain OE； PDBConstruct 1–450； UniProt 1–450 Author chain OG； PDBConstruct 1–450； UniProt 1–450 Author chain OI； PDBConstruct 1–450； UniProt 1–450 Author chain OK； PDBConstruct 1–450； UniProt 1–450 Author chain PA； PDBConstruct 1–450； UniProt 1–450 Author chain PC； PDBConstruct 1–450； UniProt 1–450 Author chain PE； PDBConstruct 1–450； UniProt 1–450 Author chain PG； PDBConstruct 1–450； UniProt 1–450 Author chain PI； PDBConstruct 1–450； UniProt 1–450 Author chain PK； PDBConstruct 1–450； UniProt 1–450 Author chain PM； PDBConstruct 1–450； UniProt 1–450 Author chain QA； PDBConstruct 1–450； UniProt 1–450 Author chain QC； PDBConstruct 1–450； UniProt 1–450 Author chain QE； PDBConstruct 1–450； UniProt 1–450 Author chain QG； PDBConstruct 1–450； UniProt 1–450 Author chain QI； PDBConstruct 1–450； UniProt 1–450 Author chain QK； PDBConstruct 1–450； UniProt 1–450 Author chain QM； PDBConstruct 1–450； UniProt 1–450 Author chain RA； PDBConstruct 1–450； UniProt 1–450 Author chain RC； PDBConstruct 1–450； UniProt 1–450 Author chain RE； PDBConstruct 1–450； UniProt 1–450 Author chain RG； PDBConstruct 1–450； UniProt 1–450 Author chain RI； PDBConstruct 1–450； UniProt 1–450 Author chain RK； PDBConstruct 1–450； UniProt 1–450 Author chain RM； PDBConstruct 1–450； UniProt 1–450 Author chain SA； PDBConstruct 1–450； UniProt 1–450 Author chain SC； PDBConstruct 1–450； UniProt 1–450 Author chain SE； PDBConstruct 1–450； UniProt 1–450 Author chain SG； PDBConstruct 1–450； UniProt 1–450 Author chain SI； PDBConstruct 1–450； UniProt 1–450 Author chain SK； PDBConstruct 1–450； UniProt 1–450 Author chain SM； PDBConstruct 1–450； UniProt 1–450 Author chain TC； PDBConstruct 1–450； UniProt 1–450 Author chain TE； PDBConstruct 1–450； UniProt 1–450 Author chain TG； PDBConstruct 1–450； UniProt 1–450 Author chain TI； PDBConstruct 1–450； UniProt 1–450 Author chain TK； PDBConstruct 1–450； UniProt 1–450 Author chain TM； PDBConstruct 1–450； UniProt 1–450 Author chain UC； PDBConstruct 1–450； UniProt 1–450 Author chain UE； PDBConstruct 1–450； UniProt 1–450 Author chain UG； PDBConstruct 1–450； UniProt 1–450 Author chain UI； PDBConstruct 1–450； UniProt 1–450 Author chain UK； PDBConstruct 1–450； UniProt 1–450 Author chain UM； PDBConstruct 1–450； UniProt 1–450 Author chain VC； PDBConstruct 1–450； UniProt 1–450 Author chain VE； PDBConstruct 1–450； UniProt 1–450 Author chain VG； PDBConstruct 1–450； UniProt 1–450 Author chain VI； PDBConstruct 1–450； UniProt 1–450 Author chain VK； PDBConstruct 1–450； UniProt 1–450 Author chain VM； PDBConstruct 1–450； UniProt 1–450 Author chain WC； PDBConstruct 1–450； UniProt 1–450 Author chain WE； PDBConstruct 1–450； UniProt 1–450 Author chain WG； PDBConstruct 1–450； UniProt 1–450 Author chain WI； PDBConstruct 1–450； UniProt 1–450 Author chain WK； PDBConstruct 1–450； UniProt 1–450 Author chain WM； PDBConstruct 1–450； UniProt 1–450

Tubulin beta-4B chain

OrganismNot specified

UniProt Q3MHM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB4B_BOVIN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AB； PDBConstruct 1–445； UniProt 1–445 Author chain AD； PDBConstruct 1–445； UniProt 1–445 Author chain AF； PDBConstruct 1–445； UniProt 1–445 Author chain AH； PDBConstruct 1–445； UniProt 1–445 Author chain AJ； PDBConstruct 1–445； UniProt 1–445 Author chain AL； PDBConstruct 1–445； UniProt 1–445 Author chain BB； PDBConstruct 1–445； UniProt 1–445 Author chain BD； PDBConstruct 1–445； UniProt 1–445 Author chain BF； PDBConstruct 1–445； UniProt 1–445 Author chain BH； PDBConstruct 1–445； UniProt 1–445 Author chain BJ； PDBConstruct 1–445； UniProt 1–445 Author chain BL； PDBConstruct 1–445； UniProt 1–445 Author chain CB； PDBConstruct 1–445； UniProt 1–445 Author chain CD； PDBConstruct 1–445； UniProt 1–445 Author chain CF； PDBConstruct 1–445； UniProt 1–445 Author chain CH； PDBConstruct 1–445； UniProt 1–445 Author chain CJ； PDBConstruct 1–445； UniProt 1–445 Author chain CL； PDBConstruct 1–445； UniProt 1–445 Author chain DB； PDBConstruct 1–445； UniProt 1–445 Author chain DD； PDBConstruct 1–445； UniProt 1–445 Author chain DF； PDBConstruct 1–445； UniProt 1–445 Author chain DH； PDBConstruct 1–445； UniProt 1–445 Author chain DJ； PDBConstruct 1–445； UniProt 1–445 Author chain DL； PDBConstruct 1–445； UniProt 1–445 Author chain DN； PDBConstruct 1–445； UniProt 1–445 Author chain EB； PDBConstruct 1–445； UniProt 1–445 Author chain ED； PDBConstruct 1–445； UniProt 1–445 Author chain EF； PDBConstruct 1–445； UniProt 1–445 Author chain EH； PDBConstruct 1–445； UniProt 1–445 Author chain EJ； PDBConstruct 1–445； UniProt 1–445 Author chain EL； PDBConstruct 1–445； UniProt 1–445 Author chain EN； PDBConstruct 1–445； UniProt 1–445 Author chain FB； PDBConstruct 1–445； UniProt 1–445 Author chain FD； PDBConstruct 1–445； UniProt 1–445 Author chain FF； PDBConstruct 1–445； UniProt 1–445 Author chain FH； PDBConstruct 1–445； UniProt 1–445 Author chain FJ； PDBConstruct 1–445； UniProt 1–445 Author chain FL； PDBConstruct 1–445； UniProt 1–445 Author chain FN； PDBConstruct 1–445； UniProt 1–445 Author chain GB； PDBConstruct 1–445； UniProt 1–445 Author chain GD； PDBConstruct 1–445； UniProt 1–445 Author chain GF； PDBConstruct 1–445； UniProt 1–445 Author chain GH； PDBConstruct 1–445； UniProt 1–445 Author chain GJ； PDBConstruct 1–445； UniProt 1–445 Author chain GL； PDBConstruct 1–445； UniProt 1–445 Author chain GN； PDBConstruct 1–445； UniProt 1–445 Author chain HB； PDBConstruct 1–445； UniProt 1–445 Author chain HD； PDBConstruct 1–445； UniProt 1–445 Author chain HF； PDBConstruct 1–445； UniProt 1–445 Author chain HH； PDBConstruct 1–445； UniProt 1–445 Author chain HJ； PDBConstruct 1–445； UniProt 1–445 Author chain HL； PDBConstruct 1–445； UniProt 1–445 Author chain HN； PDBConstruct 1–445； UniProt 1–445 Author chain IB； PDBConstruct 1–445； UniProt 1–445 Author chain ID； PDBConstruct 1–445； UniProt 1–445 Author chain IF； PDBConstruct 1–445； UniProt 1–445 Author chain IH； PDBConstruct 1–445； UniProt 1–445 Author chain IJ； PDBConstruct 1–445； UniProt 1–445 Author chain IL； PDBConstruct 1–445； UniProt 1–445 Author chain IN； PDBConstruct 1–445； UniProt 1–445 Author chain JB； PDBConstruct 1–445； UniProt 1–445 Author chain JD； PDBConstruct 1–445； UniProt 1–445 Author chain JF； PDBConstruct 1–445； UniProt 1–445 Author chain JH； PDBConstruct 1–445； UniProt 1–445 Author chain JJ； PDBConstruct 1–445； UniProt 1–445 Author chain JL； PDBConstruct 1–445； UniProt 1–445 Author chain JN； PDBConstruct 1–445； UniProt 1–445 Author chain KB； PDBConstruct 1–445； UniProt 1–445 Author chain KD； PDBConstruct 1–445； UniProt 1–445 Author chain KF； PDBConstruct 1–445； UniProt 1–445 Author chain KH； PDBConstruct 1–445； UniProt 1–445 Author chain KJ； PDBConstruct 1–445； UniProt 1–445 Author chain KL； PDBConstruct 1–445； UniProt 1–445 Author chain KN； PDBConstruct 1–445； UniProt 1–445 Author chain LB； PDBConstruct 1–445； UniProt 1–445 Author chain LD； PDBConstruct 1–445； UniProt 1–445 Author chain LF； PDBConstruct 1–445； UniProt 1–445 Author chain LH； PDBConstruct 1–445； UniProt 1–445 Author chain LJ； PDBConstruct 1–445； UniProt 1–445 Author chain LL； PDBConstruct 1–445； UniProt 1–445 Author chain LN； PDBConstruct 1–445； UniProt 1–445 Author chain MB； PDBConstruct 1–445； UniProt 1–445 Author chain MD； PDBConstruct 1–445； UniProt 1–445 Author chain MF； PDBConstruct 1–445； UniProt 1–445 Author chain MH； PDBConstruct 1–445； UniProt 1–445 Author chain MJ； PDBConstruct 1–445； UniProt 1–445 Author chain ML； PDBConstruct 1–445； UniProt 1–445 Author chain MN； PDBConstruct 1–445； UniProt 1–445 Author chain N0； PDBConstruct 1–445； UniProt 1–445 Author chain NB； PDBConstruct 1–445； UniProt 1–445 Author chain ND； PDBConstruct 1–445； UniProt 1–445 Author chain NF； PDBConstruct 1–445； UniProt 1–445 Author chain NH； PDBConstruct 1–445； UniProt 1–445 Author chain NJ； PDBConstruct 1–445； UniProt 1–445 Author chain NL； PDBConstruct 1–445； UniProt 1–445 Author chain O0； PDBConstruct 1–445； UniProt 1–445 Author chain OB； PDBConstruct 1–445； UniProt 1–445 Author chain OD； PDBConstruct 1–445； UniProt 1–445 Author chain OF； PDBConstruct 1–445； UniProt 1–445 Author chain OH； PDBConstruct 1–445； UniProt 1–445 Author chain OJ； PDBConstruct 1–445； UniProt 1–445 Author chain OL； PDBConstruct 1–445； UniProt 1–445 Author chain PB； PDBConstruct 1–445； UniProt 1–445 Author chain PD； PDBConstruct 1–445； UniProt 1–445 Author chain PF； PDBConstruct 1–445； UniProt 1–445 Author chain PH； PDBConstruct 1–445； UniProt 1–445 Author chain PJ； PDBConstruct 1–445； UniProt 1–445 Author chain PL； PDBConstruct 1–445； UniProt 1–445 Author chain QB； PDBConstruct 1–445； UniProt 1–445 Author chain QD； PDBConstruct 1–445； UniProt 1–445 Author chain QF； PDBConstruct 1–445； UniProt 1–445 Author chain QH； PDBConstruct 1–445； UniProt 1–445 Author chain QJ； PDBConstruct 1–445； UniProt 1–445 Author chain QL； PDBConstruct 1–445； UniProt 1–445 Author chain RB； PDBConstruct 1–445； UniProt 1–445 Author chain RD； PDBConstruct 1–445； UniProt 1–445 Author chain RF； PDBConstruct 1–445； UniProt 1–445 Author chain RH； PDBConstruct 1–445； UniProt 1–445 Author chain RJ； PDBConstruct 1–445； UniProt 1–445 Author chain RL； PDBConstruct 1–445； UniProt 1–445 Author chain SB； PDBConstruct 1–445； UniProt 1–445 Author chain SD； PDBConstruct 1–445； UniProt 1–445 Author chain SF； PDBConstruct 1–445； UniProt 1–445 Author chain SH； PDBConstruct 1–445； UniProt 1–445 Author chain SJ； PDBConstruct 1–445； UniProt 1–445 Author chain SL； PDBConstruct 1–445； UniProt 1–445 Author chain TB； PDBConstruct 1–445； UniProt 1–445 Author chain TD； PDBConstruct 1–445； UniProt 1–445 Author chain TF； PDBConstruct 1–445； UniProt 1–445 Author chain TH； PDBConstruct 1–445； UniProt 1–445 Author chain TJ； PDBConstruct 1–445； UniProt 1–445 Author chain TL； PDBConstruct 1–445； UniProt 1–445 Author chain UB； PDBConstruct 1–445； UniProt 1–445 Author chain UD； PDBConstruct 1–445； UniProt 1–445 Author chain UF； PDBConstruct 1–445； UniProt 1–445 Author chain UH； PDBConstruct 1–445； UniProt 1–445 Author chain UJ； PDBConstruct 1–445； UniProt 1–445 Author chain UL； PDBConstruct 1–445； UniProt 1–445 Author chain UN； PDBConstruct 1–445； UniProt 1–445 Author chain VB； PDBConstruct 1–445； UniProt 1–445 Author chain VD； PDBConstruct 1–445； UniProt 1–445 Author chain VF； PDBConstruct 1–445； UniProt 1–445 Author chain VH； PDBConstruct 1–445； UniProt 1–445 Author chain VJ； PDBConstruct 1–445； UniProt 1–445 Author chain VL； PDBConstruct 1–445； UniProt 1–445 Author chain VN； PDBConstruct 1–445； UniProt 1–445 Author chain WB； PDBConstruct 1–445； UniProt 1–445 Author chain WD； PDBConstruct 1–445； UniProt 1–445 Author chain WF； PDBConstruct 1–445； UniProt 1–445 Author chain WH； PDBConstruct 1–445； UniProt 1–445 Author chain WJ； PDBConstruct 1–445； UniProt 1–445 Author chain WL； PDBConstruct 1–445； UniProt 1–445 Author chain WN； PDBConstruct 1–445； UniProt 1–445

Cilia- and flagella-associated protein 53

OrganismNot specified

UniProt F1N7G5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA53_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain AT； PDBConstruct 1–514； UniProt 1–514 Author chain AU； PDBConstruct 1–514； UniProt 1–514

Nucleoside diphosphate kinase 7

OrganismNot specified

UniProt Q5E9Y9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDK7_BOVIN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain AV； PDBConstruct 1–377； UniProt 1–377 Author chain AW； PDBConstruct 1–377； UniProt 1–377

EF-hand domain-containing family member C2

OrganismNot specified

UniProt A0A3Q1N1R0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC2_BOVIN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–733； UniProt 1–733 Author chain Ab； PDBConstruct 1–733； UniProt 1–733 Author chain Ac； PDBConstruct 1–733； UniProt 1–733 Author chain Ad； PDBConstruct 1–733； UniProt 1–733

Family with sequence similarity 166 member A

OrganismNot specified

UniProt G3X6E2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G3X6E2_BOVIN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Al； PDBConstruct 1–320； UniProt 1–320 Author chain Am； PDBConstruct 1–320； UniProt 1–320 Author chain An； PDBConstruct 1–320； UniProt 1–320 Author chain Ao； PDBConstruct 1–320； UniProt 1–320 Author chain B7； PDBConstruct 1–320； UniProt 1–320 Author chain BY； PDBConstruct 1–320； UniProt 1–320 Author chain BZ； PDBConstruct 1–320； UniProt 1–320 Author chain Ba； PDBConstruct 1–320； UniProt 1–320 Author chain Bb； PDBConstruct 1–320； UniProt 1–320 Author chain Bc； PDBConstruct 1–320； UniProt 1–320 Author chain Bd； PDBConstruct 1–320； UniProt 1–320 Author chain Be； PDBConstruct 1–320； UniProt 1–320 Author chain CN； PDBConstruct 1–320； UniProt 1–320 Author chain CO； PDBConstruct 1–320； UniProt 1–320

Protein FAM166C

OrganismNot specified

UniProt Q3SZR5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F166C_BOVIN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Ap； PDBConstruct 1–201； UniProt 1–201 Author chain Aq； PDBConstruct 1–201； UniProt 1–201 Author chain Ar； PDBConstruct 1–201； UniProt 1–201

Spermatid-specific manchette-related protein 1

OrganismNot specified

UniProt Q32KP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMRP1_BOVIN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain B0； PDBConstruct 1–304； UniProt 1–304 Author chain B1； PDBConstruct 1–304； UniProt 1–304 Author chain B2； PDBConstruct 1–304； UniProt 1–304 Author chain B3； PDBConstruct 1–304； UniProt 1–304 Author chain B4； PDBConstruct 1–304； UniProt 1–304 Author chain B8； PDBConstruct 1–304； UniProt 1–304 Author chain B9； PDBConstruct 1–304； UniProt 1–304 Author chain CQ； PDBConstruct 1–304； UniProt 1–304 Author chain CR； PDBConstruct 1–304； UniProt 1–304 Author chain CS； PDBConstruct 1–304； UniProt 1–304

Enkurin

OrganismNot specified

UniProt E1B836

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ENKUR_BOVIN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain B5； PDBConstruct 1–259； UniProt 1–259 Author chain B6； PDBConstruct 1–259； UniProt 1–259 Author chain By； PDBConstruct 1–259； UniProt 1–259 Author chain Bz； PDBConstruct 1–259； UniProt 1–259

Coiled-coil domain-containing protein 105

OrganismNot specified

UniProt Q2YDN4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CC105_BOVIN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain BO； PDBConstruct 1–500； UniProt 1–500 Author chain BP； PDBConstruct 1–500； UniProt 1–500 Author chain BQ； PDBConstruct 1–500； UniProt 1–500 Author chain BR； PDBConstruct 1–500； UniProt 1–500

Protein phosphatase 1 regulatory subunit 32

OrganismNot specified

UniProt Q2T9T0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPR32_BOVIN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain BS； PDBConstruct 1–428； UniProt 1–428 Author chain BT； PDBConstruct 1–428； UniProt 1–428

RIB43A-like with coiled-coils protein 2

OrganismNot specified

UniProt Q32LJ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RIBC2_BOVIN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain BU； PDBConstruct 1–377； UniProt 1–377 Author chain BV； PDBConstruct 1–377； UniProt 1–377 Author chain Bi； PDBConstruct 1–377； UniProt 1–377 Author chain Bj； PDBConstruct 1–377； UniProt 1–377 Author chain Bk； PDBConstruct 1–377； UniProt 1–377

Cilia- and flagella-associated protein 107

OrganismNot specified

UniProt Q2TA11

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF107_BOVIN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain BW； PDBConstruct 1–196； UniProt 1–196 Author chain BX； PDBConstruct 1–196； UniProt 1–196

Piercer of microtubule wall 1 protein

OrganismNot specified

UniProt Q32P67

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PIRC1_BOVIN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Bf； PDBConstruct 1–136； UniProt 1–136 Author chain Bg； PDBConstruct 1–136； UniProt 1–136

Piercer of microtubule wall 2 protein

OrganismNot specified

UniProt A0A3Q1LFK7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PIRC2_BOVIN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Bh； PDBConstruct 1–120； UniProt 1–120

Meiosis-specific nuclear structural protein 1

OrganismNot specified

UniProt Q2KIQ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MNS1_BOVIN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain Br； PDBConstruct 1–495； UniProt 1–495 Author chain Bs； PDBConstruct 1–495； UniProt 1–495

Tektin-3

OrganismNot specified

UniProt A6H782

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT3_BOVIN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain C0； PDBConstruct 1–490； UniProt 1–490 Author chain C2； PDBConstruct 1–490； UniProt 1–490 Author chain C3； PDBConstruct 1–490； UniProt 1–490 Author chain C4； PDBConstruct 1–490； UniProt 1–490 Author chain C5； PDBConstruct 1–490； UniProt 1–490 Author chain C6； PDBConstruct 1–490； UniProt 1–490 Author chain C7； PDBConstruct 1–490； UniProt 1–490 Author chain C8； PDBConstruct 1–490； UniProt 1–490 Author chain C9； PDBConstruct 1–490； UniProt 1–490 Author chain DO； PDBConstruct 1–490； UniProt 1–490 Author chain F2； PDBConstruct 1–490； UniProt 1–490 Author chain F3； PDBConstruct 1–490； UniProt 1–490 Author chain F4； PDBConstruct 1–490； UniProt 1–490 Author chain F5； PDBConstruct 1–490； UniProt 1–490 Author chain F6； PDBConstruct 1–490； UniProt 1–490

Tektin-5

OrganismNot specified

UniProt Q2YDI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT5_BOVIN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain C1； PDBConstruct 1–489； UniProt 1–489 Author chain Cz； PDBConstruct 1–489； UniProt 1–489 Author chain D0； PDBConstruct 1–489； UniProt 1–489 Author chain D1； PDBConstruct 1–489； UniProt 1–489 Author chain D2； PDBConstruct 1–489； UniProt 1–489 Author chain D3； PDBConstruct 1–489； UniProt 1–489 Author chain D4； PDBConstruct 1–489； UniProt 1–489 Author chain D5； PDBConstruct 1–489； UniProt 1–489 Author chain D6； PDBConstruct 1–489； UniProt 1–489 Author chain D7； PDBConstruct 1–489； UniProt 1–489 Author chain D8； PDBConstruct 1–489； UniProt 1–489 Author chain D9； PDBConstruct 1–489； UniProt 1–489 Author chain DP； PDBConstruct 1–489； UniProt 1–489 Author chain DQ； PDBConstruct 1–489； UniProt 1–489 Author chain DR； PDBConstruct 1–489； UniProt 1–489 Author chain DS； PDBConstruct 1–489； UniProt 1–489 Author chain DT； PDBConstruct 1–489； UniProt 1–489 Author chain DU； PDBConstruct 1–489； UniProt 1–489 Author chain DV； PDBConstruct 1–489； UniProt 1–489 Author chain DW； PDBConstruct 1–489； UniProt 1–489 Author chain DX； PDBConstruct 1–489； UniProt 1–489 Author chain EA； PDBConstruct 1–489； UniProt 1–489 Author chain EO； PDBConstruct 1–489； UniProt 1–489 Author chain EP； PDBConstruct 1–489； UniProt 1–489 Author chain EQ； PDBConstruct 1–489； UniProt 1–489 Author chain ER； PDBConstruct 1–489； UniProt 1–489

Sperm-associated antigen 8

OrganismNot specified

UniProt E1BNS6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAG8_BOVIN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain CW； PDBConstruct 1–484； UniProt 1–484

Tektin-1

OrganismNot specified

UniProt Q32KZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT1_BOVIN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Cm； PDBConstruct 1–418； UniProt 1–418 Author chain Cn； PDBConstruct 1–418； UniProt 1–418 Author chain Co； PDBConstruct 1–418； UniProt 1–418 Author chain Cp； PDBConstruct 1–418； UniProt 1–418

Tektin-2

OrganismNot specified

UniProt Q2T9Q6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT2_BOVIN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Cq； PDBConstruct 1–430； UniProt 1–430 Author chain Cr； PDBConstruct 1–430； UniProt 1–430 Author chain Cs； PDBConstruct 1–430； UniProt 1–430 Author chain Ct； PDBConstruct 1–430； UniProt 1–430 Author chain Cu； PDBConstruct 1–430； UniProt 1–430 Author chain Cv； PDBConstruct 1–430； UniProt 1–430 Author chain Cw； PDBConstruct 1–430； UniProt 1–430 Author chain Cx； PDBConstruct 1–430； UniProt 1–430 Author chain Cy； PDBConstruct 1–430； UniProt 1–430

Uncharacterized protein C1orf100 homolog

OrganismNot specified

UniProt Q32L72

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CA100_BOVIN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain D； PDBConstruct 1–138； UniProt 1–138

TEPP protein

OrganismNot specified

UniProt C9QNT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C9QNT9_BOVIN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain DY； PDBConstruct 1–216； UniProt 1–216 Author chain DZ； PDBConstruct 1–216； UniProt 1–216 Author chain Da； PDBConstruct 1–216； UniProt 1–216 Author chain Ee； PDBConstruct 1–216； UniProt 1–216

Uncharacterized protein MGC137036

OrganismNot specified

UniProt A0A3Q1LFG5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1LFG5_BOVIN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain Db； PDBConstruct 1–192； UniProt 1–192 Author chain Dc； PDBConstruct 1–192； UniProt 1–192 Author chain Dd； PDBConstruct 1–192； UniProt 1–192

Testis expressed 33

OrganismNot specified

UniProt Q32LI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q32LI7_BOVIN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain De； PDBConstruct 1–272； UniProt 1–272

Testis-expressed sequence 37 protein

OrganismNot specified

UniProt A5PJD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEX37_BOVIN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain Df； PDBConstruct 1–180； UniProt 1–180 Author chain Dg； PDBConstruct 1–180； UniProt 1–180 Author chain Dh； PDBConstruct 1–180； UniProt 1–180

Testis-expressed protein 43

OrganismNot specified

UniProt A8SMG2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEX43_BOVIN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain Di； PDBConstruct 1–133； UniProt 1–133 Author chain Dj； PDBConstruct 1–133； UniProt 1–133 Author chain Dk； PDBConstruct 1–133； UniProt 1–133 Author chain Dl； PDBConstruct 1–133； UniProt 1–133

Testis expressed 49

OrganismNot specified

UniProt A0A3Q1MT14

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1MT14_BOVIN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain Dm； PDBConstruct 1–131； UniProt 1–131

Theg spermatid protein like

OrganismNot specified

UniProt A0A3Q1MNS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1MNS9_BOVIN
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain Dn； PDBConstruct 1–450； UniProt 1–450

EF-hand domain-containing family member B

OrganismNot specified

UniProt F1MMV1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHB_BOVIN
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain E； PDBConstruct 1–877； UniProt 1–877 Author chain F； PDBConstruct 1–877； UniProt 1–877

Tektin bundle interacting protein 1

OrganismNot specified

UniProt F1MZJ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1MZJ1_BOVIN
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain E1； PDBConstruct 1–208； UniProt 1–208 Author chain E2； PDBConstruct 1–208； UniProt 1–208 Author chain E3； PDBConstruct 1–208； UniProt 1–208 Author chain E4； PDBConstruct 1–208； UniProt 1–208

Tektin-4

OrganismNot specified

UniProt Q2TA38

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT4_BOVIN
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain ES； PDBConstruct 1–447； UniProt 1–447 Author chain ET； PDBConstruct 1–447； UniProt 1–447 Author chain EU； PDBConstruct 1–447； UniProt 1–447 Author chain EV； PDBConstruct 1–447； UniProt 1–447 Author chain EW； PDBConstruct 1–447； UniProt 1–447 Author chain EX； PDBConstruct 1–447； UniProt 1–447 Author chain EY； PDBConstruct 1–447； UniProt 1–447 Author chain EZ； PDBConstruct 1–447； UniProt 1–447

Cilia- and flagella- associated protein 210

OrganismNot specified

UniProt E1BJL9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF210_BOVIN
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain H； PDBConstruct 1–547； UniProt 1–547 Author chain o； PDBConstruct 1–547； UniProt 1–547

EF-hand domain-containing protein 1

OrganismNot specified

UniProt E1BKH1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC1_BOVIN
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain I； PDBConstruct 1–640； UniProt 1–640 Author chain X； PDBConstruct 1–640； UniProt 1–640 Author chain Y； PDBConstruct 1–640； UniProt 1–640

Uncharacterized protein C10orf82 homolog

OrganismNot specified

UniProt A6QPC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CJ082_BOVIN
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain J； PDBConstruct 1–235； UniProt 1–235 Author chain K； PDBConstruct 1–235； UniProt 1–235 Author chain L； PDBConstruct 1–235； UniProt 1–235 Author chain M； PDBConstruct 1–235； UniProt 1–235

Cilia- and flagella-associated protein 144

OrganismNot specified

UniProt A8QW39

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF144_BOVIN
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain K1； PDBConstruct 1–135； UniProt 1–135

Chromosome 20 C5orf49 homolog

OrganismNot specified

UniProt A0A3Q1LU45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1LU45_BOVIN
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain L1； PDBConstruct 1–147； UniProt 1–147 Author chain L2； PDBConstruct 1–147； UniProt 1–147

Chromosome 19 C17orf98 homolog

OrganismNot specified

UniProt E1BC62

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1BC62_BOVIN
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain N； PDBConstruct 1–154； UniProt 1–154 Author chain O； PDBConstruct 1–154； UniProt 1–154

Chromosome 13 C20orf85 homolog

OrganismNot specified

UniProt A0A3S5ZPE5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3S5ZPE5_BOVIN
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain P； PDBConstruct 1–137； UniProt 1–137

Cilia- and flagella-associated protein 68

OrganismNot specified

UniProt Q2T9Q3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA68_BOVIN
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain Q； PDBConstruct 1–169； UniProt 1–169

Cilia and flagella associated protein 77

OrganismNot specified

UniProt A0A3Q1LJD6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1LJD6_BOVIN
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain R； PDBConstruct 1–284； UniProt 1–284 Author chain S； PDBConstruct 1–284； UniProt 1–284 Author chain T； PDBConstruct 1–284； UniProt 1–284 Author chain U； PDBConstruct 1–284； UniProt 1–284

UPF0602 protein C4orf47 homolog

OrganismNot specified

UniProt Q2T9M0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CD047_BOVIN
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain W； PDBConstruct 1–309； UniProt 1–309

Cilia- and flagella-associated protein 20

OrganismNot specified

UniProt Q6B857

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA20_BOVIN
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain XG； PDBConstruct 1–193； UniProt 1–193 Author chain XH； PDBConstruct 1–193； UniProt 1–193 Author chain XI； PDBConstruct 1–193； UniProt 1–193 Author chain XJ； PDBConstruct 1–193； UniProt 1–193 Author chain XK； PDBConstruct 1–193； UniProt 1–193 Author chain XL； PDBConstruct 1–193； UniProt 1–193 Author chain XM； PDBConstruct 1–193； UniProt 1–193

Parkin coregulated gene protein

OrganismNot specified

UniProt A5PK71

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PACRG_BOVIN
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain YG； PDBConstruct 1–257； UniProt 1–257 Author chain YH； PDBConstruct 1–257； UniProt 1–257 Author chain YI； PDBConstruct 1–257； UniProt 1–257 Author chain YJ； PDBConstruct 1–257； UniProt 1–257 Author chain YK； PDBConstruct 1–257； UniProt 1–257 Author chain YL； PDBConstruct 1–257； UniProt 1–257

CFAP97 domain containing 1

OrganismNot specified

UniProt G3N1Q7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G3N1Q7_BOVIN
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain Z； PDBConstruct 1–164； UniProt 1–164 Author chain p； PDBConstruct 1–164； UniProt 1–164 Author chain q； PDBConstruct 1–164； UniProt 1–164

Cilia- and flagella-associated protein 45

OrganismNot specified

UniProt Q32LN4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA45_BOVIN
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain a； PDBConstruct 1–549； UniProt 1–549 Author chain b； PDBConstruct 1–549； UniProt 1–549 Author chain c； PDBConstruct 1–549； UniProt 1–549 Author chain d； PDBConstruct 1–549； UniProt 1–549

Cilia- and flagella-associated protein 52

OrganismNot specified

UniProt E1BKF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA52_BOVIN
Isoform	—
PDB entities	60
Chains and sequence ranges	Author chain e； PDBConstruct 1–623； UniProt 1–623 Author chain f； PDBConstruct 1–623； UniProt 1–623 Author chain g； PDBConstruct 1–623； UniProt 1–623

Cilia- and flagella-associated protein 141

OrganismNot specified

UniProt Q32L75

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CP141_BOVIN
Isoform	—
PDB entities	61
Chains and sequence ranges	Author chain h； PDBConstruct 1–101； UniProt 1–101

Cilia- and flagella-associated protein 161

OrganismNot specified

UniProt F6RJC2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF161_BOVIN
Isoform	—
PDB entities	62
Chains and sequence ranges	Author chain i； PDBConstruct 1–321； UniProt 1–321 Author chain j； PDBConstruct 1–321； UniProt 1–321

Dual specificity phosphatase 21

OrganismNot specified

UniProt Q0II40

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q0II40_BOVIN
Isoform	—
PDB entities	63
Chains and sequence ranges	Author chain k； PDBConstruct 1–196； UniProt 1–196 Author chain l； PDBConstruct 1–196； UniProt 1–196 Author chain m； PDBConstruct 1–196； UniProt 1–196 Author chain n； PDBConstruct 1–196； UniProt 1–196

Uncharacterized protein C4orf45 homolog

OrganismNot specified

UniProt Q2KIR0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CD045_BOVIN
Isoform	—
PDB entities	64
Chains and sequence ranges	Author chain ke； PDBConstruct 1–197； UniProt 1–197

Cilia- and flagella-associated protein 276

OrganismNot specified

UniProt E1B9I5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） EF-hand calcium-binding domain-containing protein 3 × 3 （Q2T9P0） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF276_BOVIN
Isoform	—
PDB entities	65
Chains and sequence ranges	Author chain r； PDBConstruct 1–170； UniProt 1–170 Author chain s； PDBConstruct 1–170； UniProt 1–170 Author chain t； PDBConstruct 1–170； UniProt 1–170

EF-hand calcium-binding domain-containing protein 3

OrganismNot specified

UniProt Q2T9P0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 575	Cilia- and flagella-associated protein 95 × 2 （Q32L77） Sperm acrosome associated 9 × 29 （A0A3Q1MYU9） Testis specific serine kinase 6 × 3 （F1N2S7） EF-hand domain-containing protein × 3 （G5E5A3） ATP6V1F neighbor × 3 （G3X8G1） Outer dense fiber of sperm tails 3 like 1 × 2 Outer dense fiber of sperm tails 3 × 14 （G3X6A7） Tubulin alpha-3 chain × 149 （Q32KN8） Tubulin beta-4B chain × 153 （Q3MHM5） Protein Flattop × 4 Cilia- and flagella-associated protein 53 × 2 （F1N7G5） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） EF-hand domain-containing family member C2 × 4 （A0A3Q1N1R0） Family with sequence similarity 166 member A × 14 （G3X6E2） Protein FAM166C × 3 （Q3SZR5） Outer dense fiber of sperm tails 3B × 2 Spermatid-specific manchette-related protein 1 × 10 （Q32KP0） Enkurin × 4 （E1B836） Coiled-coil domain-containing protein 105 × 4 （Q2YDN4） Protein phosphatase 1 regulatory subunit 32 × 2 （Q2T9T0） RIB43A-like with coiled-coils protein 2 × 5 （Q32LJ7） Cilia- and flagella-associated protein 107 × 2 （Q2TA11） Piercer of microtubule wall 1 protein × 2 （Q32P67） Piercer of microtubule wall 2 protein × 1 （A0A3Q1LFK7） Stabilizer of axonemal microtubules 1 × 5 Stabilizer of axonemal microtubules 3 × 2 Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Tektin-3 × 15 （A6H782） Tektin-5 × 26 （Q2YDI7） Sperm-associated antigen 8 × 1 （E1BNS6） Spermatogenesis-associated protein 48 × 1 Tektin-1 × 4 （Q32KZ9） Tektin-2 × 9 （Q2T9Q6） Uncharacterized protein C1orf100 homolog × 1 （Q32L72） TEPP protein × 4 （C9QNT9） Uncharacterized protein MGC137036 × 3 （A0A3Q1LFG5） Testis expressed 33 × 1 （Q32LI7） Testis-expressed sequence 37 protein × 3 （A5PJD8） Testis-expressed protein 43 × 4 （A8SMG2） Testis expressed 49 × 1 （A0A3Q1MT14） Theg spermatid protein like × 1 （A0A3Q1MNS9） EF-hand domain-containing family member B × 2 （F1MMV1） Tektin bundle interacting protein 1 × 4 （F1MZJ1） Tektin-4 × 8 （Q2TA38） Chromosome 7 open reading frame 31 × 1 Cilia- and flagella- associated protein 210 × 2 （E1BJL9） EF-hand domain-containing protein 1 × 3 （E1BKH1） Uncharacterized protein C10orf82 homolog × 4 （A6QPC0） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Chromosome 20 C5orf49 homolog × 2 （A0A3Q1LU45） Chromosome 19 C17orf98 homolog × 2 （E1BC62） Chromosome 13 C20orf85 homolog × 1 （A0A3S5ZPE5） Cilia- and flagella-associated protein 68 × 1 （Q2T9Q3） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） UPF0602 protein C4orf47 homolog × 1 （Q2T9M0） Cilia- and flagella-associated protein 20 × 7 （Q6B857） Parkin coregulated gene protein × 6 （A5PK71） CFAP97 domain containing 1 × 3 （G3N1Q7） Cilia- and flagella-associated protein 45 × 4 （Q32LN4） Cilia- and flagella-associated protein 52 × 3 （E1BKF9） Cilia- and flagella-associated protein 141 × 1 （Q32L75） Cilia- and flagella-associated protein 161 × 2 （F6RJC2） Dual specificity phosphatase 21 × 4 （Q0II40） Uncharacterized protein C4orf45 homolog × 1 （Q2KIR0） Cilia- and flagella-associated protein 276 × 3 （E1B9I5） GUANOSINE-5'-TRIPHOSPHATE × 149 MAGNESIUM ION × 149 GUANOSINE-5'-DIPHOSPHATE × 153	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFCB3_BOVIN
Isoform	—
PDB entities	66
Chains and sequence ranges	Author chain u； PDBConstruct 1–438； UniProt 1–438 Author chain v； PDBConstruct 1–438； UniProt 1–438 Author chain w； PDBConstruct 1–438； UniProt 1–438

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8otz
Deposition date deposition_date	2023-04-21
Structure title title	48-nm repeat of the native axonemal doublet microtubule from bovine sperm
Keywords keywords	microtubule, cilia, sperm, axoneme, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8otz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8otz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8otz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	213.90 Å
Total Rg	213.90 Å
Atom count	1456792
Residues	183096
Excluded volume	25746000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8otz__assembly_1__model_1`	575-meric （575）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (69)

Entity 1 Entity 1 polymer

Description description	Cilia- and flagella-associated protein 95
Molecular weight formula_weight	26661.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,V
Atom count atom_count	1456841

MDSSDSSCQEWCSHGQYWLELGPTDLMERKGSLTLRSHHKKYSKPVLVYSWHRDRETYPKDYDIEGPEEVKKLCNSTYRRLGTSEPPVWISETREKMAQVCLNTKLAKIKSKALLNEETMNSGIIERDTGLPATGFGALFTRHSPDWSKMCTLTTYAEEYAPPYEYQPLGDPCQDDDYSIVHRKCRSQFTDLDGSKRVGINTWHDESGIYANSYVKRKLYSLTGGPIAPFLK

Entity 2 Entity 2 polymer

Description description	Sperm acrosome associated 9
Molecular weight formula_weight	25174.8 kDa
Source method src_method	nat
Copy count entity_count	29

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0A,0C,0E,0G,0W,0Y,0a,0c,0e,0g,0i,0k,CT,CU,CV,CX,CY,CZ,Ca,Cb,Cc,Cd,Ce,Cf,Cg,Ch,Ci,Cj,Ck

MMNEVKESLRSVEQKYKIFQQQQFTFIGALEHCRENAHDKIRPISSIGQVQSYMEHHCSNSTDRRILLMFLDICSELSKLCQHFEALHAGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPIILDLMKEWVAHSEKLPRKALQQVSEPQAATRATAHAPQASGTQPQLRKQNCGQLIQNIPKPGGKDQGSSKPPWRPPGGKL

Entity 3 Entity 3 polymer

Description description	Testis specific serine kinase 6
Molecular weight formula_weight	30256.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,x

MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGGQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPDGLELSERCKALIAELLQFSPSARPSAGQVARNGWLRAGDSG

Entity 4 Entity 4 polymer

Description description	EF-hand domain-containing protein
Molecular weight formula_weight	31349.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,y,z

MPVNSKGRLRYLDFLSSFNVDKQATPLATSDSAKAQRGSSVPEVSDRGRSAGSSPTRDPKAGSKPRSHPCTPSSVSGTPPLQNCEPIETKLRKKVQGCWRELLRECKERDFNKQGEIPGPEFLALVEKFNLDISRDECQQLLIKYDLKNNGKFAYCSFIQSCVLLLKAKETSLMQRMKIQNANKMKEAGAETCSFYSALLRIQPKIVHCWRPMRRTFKAYDEGGTGLLSVADFRKVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFLQ

Entity 5 Entity 5 polymer

Description description	ATP6V1F neighbor
Molecular weight formula_weight	20279.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C

MSRQLSMDTVRQNFWKEEYLREKMLRCEWHHKYGSLVKAKQKAKAAARLPLKLPTLPPKAPLSPPPTPKAVPSRASSPALEAPIQSEMYPVPPATRALLYEGISHDFQGRYRYLSTRKLDVPEKRYLFPITTNFTYGWQLGPPVKQELVSCKMCRIESFFRKNGAFSLLDPRDLAL

Entity 6 Entity 6 polymer

Description description	Outer dense fiber of sperm tails 3 like 1
Molecular weight formula_weight	30860.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A0,BN

MKLPKGVKNPVFYGQQPEKKVPMSSGHEIKQTPVVLAMLKGPGPAKYLRPSCTGYIDHDVSMFQEPAYTLHAWHPEKRIMDIRSPGPCYFLDPKITRFGMVSCPQVPMAEHISNLRLSPTPAPCHYHLEKTHLPGERRAPGYSFGFRCPYRVMDPNPGPNRYQMPLLLGPNLPANKAAPCYSLAPLDKNWFYKNMSRGPGPAAHTRPEPSVYQNRSPVYSMAKRFGYPVDHTPRPGPGSHNVQQVRAHKPRPPAFTMGIKHSPHLCPLIVDIRD

Entity 7 Entity 7 polymer

Description description	Outer dense fiber of sperm tails 3
Molecular weight formula_weight	27684.9 kDa
Source method src_method	nat
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,A2,A3,A4,A5,A6,A7,A8,A9,Au,Av,Aw,Ay,Az

MAEEVWVGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFVKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYSVNPKILRTGKDLGPAYSILGRYHTKTTLTPGPGDYFPEKSTKHVFDSAPSHSISARTKTFRVDSTPGPAAYMLPMVMGPHTIGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTDVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTMTRPCAPVVSFGIKHSDYMTPLVVDVD

Entity 8 Entity 8 polymer

Description description	Tubulin alpha-3 chain
Molecular weight formula_weight	49978.3 kDa
EC 编号 ec_number	3.6.5.-
Source method src_method	nat
Copy count entity_count	149

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;AA,AC,AE,AG,AI,AK,AM,BA,BC,BE,BG,BI,BK,BM,CA,CC,CE,CG,CI,CK,CM,DA,DC,DE,DG,DI,DK,DM,EC,EE,EG,EI,EK,EM,FC,FE,FG,FI,FK,FM,GC,GE,GG,GI,GK,GM,HC,HE,HG,HI,HK,HM,HO,IC,IE,IG,II,IK,IM,IO,JC,JE,JG,JI,JK,JM,KC,KE,KG,KI,KK,KM,KO,LC,LE,LG,LI,LK,LM,MC,ME,MG,MI,MK,MM,NA,NC,NE,NG,NI,NK,OA,OC,OE,OG,OI,OK,PA,PC,PE,PG,PI,PK,PM,QA,QC,QE,QG,QI,QK,QM,RA,RC,RE,RG,RI,RK,RM,SA,SC,SE,SG,SI,SK,SM,TC,TE,TG,TI,TK,TM,UC,UE,UG,UI,UK,UM,VC,VE,VG,VI,VK,VM,WC,WE,WG,WI,WK,WM ;

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKLDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSVEAEAEEGEEY

Entity 9 Entity 9 polymer

Description description	Tubulin beta-4B chain
Molecular weight formula_weight	49877.8 kDa
Source method src_method	nat
Copy count entity_count	153

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;AB,AD,AF,AH,AJ,AL,BB,BD,BF,BH,BJ,BL,CB,CD,CF,CH,CJ,CL,DB,DD,DF,DH,DJ,DL,DN,EB,ED,EF,EH,EJ,EL,EN,FB,FD,FF,FH,FJ,FL,FN,GB,GD,GF,GH,GJ,GL,GN,HB,HD,HF,HH,HJ,HL,HN,IB,ID,IF,IH,IJ,IL,IN,JB,JD,JF,JH,JJ,JL,JN,KB,KD,KF,KH,KJ,KL,KN,LB,LD,LF,LH,LJ,LL,LN,MB,MD,MF,MH,MJ,ML,MN,N0,NB,ND,NF,NH,NJ,NL,O0,OB,OD,OF,OH,OJ,OL,PB,PD,PF,PH,PJ,PL,QB,QD,QF,QH,QJ,QL,RB,RD,RF,RH,RJ,RL,SB,SD,SF,SH,SJ,SL,TB,TD,TF,TH,TJ,TL,UB,UD,UF,UH,UJ,UL,UN,VB,VD,VF,VH,VJ,VL,VN,WB,WD,WF,WH,WJ,WL,WN ;

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Entity 10 Entity 10 polymer

Description description	Protein Flattop
Molecular weight formula_weight	21214.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP,AQ,AR,AS

MATNYSANQYEKPFSPKYLQNWSLAKPTKERISSHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLKVPPARATLTSRTAAGAASLTRWIQKNPDLLKASNGLRPEIFGKPHDPDSQKKLRKSITKTVQQAPSPTIIPSSPASNLSSPDQLQSSHPSAGHTPGPQSPLNSPKCPPGSPCLPHAGRNLAEV

Entity 11 Entity 11 polymer

Description description	Cilia- and flagella-associated protein 53
Molecular weight formula_weight	62139.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AT,AU

MYSQRFGIVQREVKGPTPKVVIVRAKPPKGQGAEHHLQRIQHSHQKHHAILASIKSIERDRLKTEWDQHNDCKFVDSLVKARVKDAMQGFIINTEERRNKLRELLASEENEYFTEMQLKEETIEEKKDRMRDKIRLLREKKEKERQDFVAEKLDQQFRERCQELRAELFCIHQKAVCEERKAQIAFNEELKRQKVVEEQMFSKLWEEDRLAKERREAKEERRQKELVENTRLGLNAQVTSIQAQRQAAQRLKEEEALLVENENAQVKLENEQDKLKKQKTKQEIRAALQKALQEKMERMQQEYREEQDLNMKLMQNALQSLQEETDKKKQKKEDMRREQKIYYQYLAQRHEEEKAQEKELDRMLEKEKEKKFAEKDKELRLEKEARKQLLNEVMCTRKLQVQEKLQRKAKEQEERTMEQERINEGLKELNCEERENFIRRCSLAQEYRKQLQMQICSQQQAREAEEEEERREFEAGIAAEKSFQDKIQGILSTHQVVPRNIHPMRRACSTKLPP

Entity 12 Entity 12 polymer

Description description	Nucleoside diphosphate kinase 7
Molecular weight formula_weight	42650.9 kDa
EC 编号 ec_number	2.7.4.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AV,AW

MNHSERFVFIAEWFDPNASLFRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYEDLHLEDLFIGNKVNIFSRQLVLLDYGDQYTARQLGSKKEKTLALIKPDAVSKAGEIIEIINKAGFTLTKLKMMTLSRKEATDFHIDHQSRPFLNELIQFITSGPIIAMEILRDDAVCEWKRLLGPANSGLARTDAPESIRALFGTDGIKNAAHGPDSFACAAREMELFFPSSGVCGPANTAKFTNCTTCCIVKPHAVSEGLLGKILMTIRDAGFEISAMQMFNMDRINVEEFYEVYKGVVSEYNEMVTEMYSGPCVAMEIQQTNPTMTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILDN

Entity 13 Entity 13 polymer

Description description	EF-hand domain-containing family member C2
Molecular weight formula_weight	85566.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ab,Ac,Ad

MGKEKFHKSQHWGFCNNVRMLVGEDKPGIGGELLFGQKIKPKYSVFPKGMGTDSPSWVAFDKQVLSFDAYLEDEVPDKSQENYRIRRYKIYFYLEDDTVEVNEPVLQNSGLPQGIFIRRHRISLPPPNEDQFYTVHHFNVNTDIVFYGRTFKVYDCDAFTKNFLTKIGVKLNPPGQCPEDPYMKTRREKLDCMEPICPYESFDTLKQFLEYDRKVLRFFCVWDDSGSVFGDRRELILHYFLSDDTIEIKEVLPHNSGRDAMSLFLQRRKLPKYGPPGVYQPGQLTDQTVLNVYGGYSETRVYGFLLDKYQLGKLDQEFYKDTDLSIGTTINVWGRKVLLCDCDDFTKTYYRTKYGIENFTSIPCKAPSPPKIERKFPPYTGFGSEEDSLRSCIGLMPTPHQRNFKKFIEFDSYGNISNTLRFFAKLITHKCADVERMFVISYFLSDDTISVFEPIERNSGYTGGMFLKRVRVKKPGQEVFKSEFSEYIKAEELYVGAKVNVNGYLFFLVNADEYTLNYMERNSDKFPLSSIELVIQKLKEEECKSRELKQVFTAADCMHTKMVDFNTFREIMMNLTVGKLTDQEVITIARRYRVPEDPCPHRNVLVAQAHEQLKKNAFENFERLIAMCVYEDREKKKVLPSKDIKRLCKSSRLPLNEDLLGSLLSGFEDSEKQINYESFFCALNWRVNPVPVLEVASYIKERCEDEWLGMPSPIPVKYIYYLNLLKDVFGVDE

Entity 14 Entity 14 polymer

Description description	Family with sequence similarity 166 member A
Molecular weight formula_weight	36251.4 kDa
Source method src_method	nat
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Al,Am,An,Ao,B7,BY,BZ,Ba,Bb,Bc,Bd,Be,CN,CO

MTAPQKHNLFSPEPHYIPGYAGFYPQLRYRVGDTYGRTTAQLLTDPSVQKSPCSVLAPVAKPKFIEDFSKPKPPFVPCRDLIEPYIPHYTGLKPYKNFEMLGRFPPQEADAQGSLGGENVSRQVPLPAGFMPYPPYAPCPPGRKGDSRDLGHPGLRLALGEEAWKSTAPACEAPGQYQLYHCRRDESPPLAHWQETLDVGRFHRLPQLGHPKLIQRKAISGYAGFVPRFAWVMGMNYRDGVTQAMDEFDKSQFLLRNPICALGERLPSTHWPSNTIYRSQGLIPFYMGFIPSMQDNYALTFGNSTRKAYQKELERRSRTL

Entity 15 Entity 15 polymer

Description description	Protein FAM166C
Molecular weight formula_weight	23414.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ap,Aq,Ar

MASRSAGTLLTEFNAAYVPPGLMPGYKGHVPGVAFSFGSPYGTTTLKYFQDQRNAALGRSSTAFSRGGHFPTIFSLNPTQVLRNRALTRDRWLHTPSYTRFNLDSSRWAELLHFYQMAQRHREHYQDKTGLVHRVPYFVLPVKEWDRYPIPTDLPPLSPKEKWHLLRVAPENLRTYQTFPSGKRVSPQERQRRDCYFEFRA

Entity 16 Entity 16 polymer

Description description	Outer dense fiber of sperm tails 3B
Molecular weight formula_weight	32579.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	At,Ax

MGSGSWALQWWGSRHPTLPSQPGDTGTGVAGRKRSHRAMGSDVWVGPWRPHRPRGPIGALYRGPGPKYKLPPSTGYIMHDPSRPRAPAFTFGARLPAQQTSCGPGPGHLVPARMTVRGLDSAPAYSIFGRPRHAAPFLTPGPGRYFPERAGNAAYPSAPRHTIAPRNWGLRLESQTPGPGTYTMPSLLGPRVVGKVSAPNYSIYGRSAVGSFCEDLSKTPGPCAYHAVNPGVYKPRAPQFSMLPRTSFPQGNTLNPGPAAYNVDQHRKPRGWTFGIRHSDYLAPMMTEADGDPLGGRCAADVS

Entity 17 Entity 17 polymer

Description description	Spermatid-specific manchette-related protein 1
Molecular weight formula_weight	35109.0 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B0,B1,B2,B3,B4,B8,B9,CQ,CR,CS

MFLFSRKTKTPISTYSDSYRAPTSIKEVYKDPPLWAWEANKFVTPGLTHTAQRHVDPDALQKMLKCAVQDYSYKGSIPSHPYFPEKYWLCPEEADRCNPNYLCGNPNYLCSNQYNTWRMGPYNCWNKCTTYLPRLPKEAGMETVVRGMPLVYPPKPERLNAYEREVVVNMLNSLSRNQPLPQITPRCGCVDPLPGRLPFQGYESACSGRHYCLRGMDYCVSGPPCTERRLRPLCTELPTVRSVSPCEHRSGMQCAVITPQPSYYPCPNLRWDTSHFKKTGGSQRNNYVVHPEFVSETYPDYHCW

Entity 18 Entity 18 polymer

Description description	Enkurin
Molecular weight formula_weight	30215.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B5,B6,By,Bz

MVAMDPTGPSESIYNLIPSDWKEPPQPPRYVSIFKATVKDDMQKFKTAMKTMGPAKLEVPSPKDFLKKHSKEKILPPKKKFEWNERRKPPVPLRTDHPVMGIQSEKNFINTNAADVIMGVAKKPKPIYVDKRTGDKHDLETSGLVPKYINKKDYGVTPEYICKRNEEVKKAQEEYDNYIQENLRKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQKLEEEMKQLEHDIGVLEKHKVIYIANKK

Entity 19 Entity 19 polymer

Description description	Coiled-coil domain-containing protein 105
Molecular weight formula_weight	57747.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO,BP,BQ,BR

MPVLIPPVEHSQDTRVGHPAWREATRALAEEAHQLTDRCGQEAVTMWQPNESVRDPHVAHHLCRAAYILPWRFRVEMLKGGSTMEKPPPGEGVTLWKSKMKPPAWHARLPLPMHRDARALQTAEVVQAHARGARLTAARLGRAQHQINGQLRLLQRQREATDRRLSEVRKALLINQQSVKLRGYRPKSETISDKADSMLTWEKEELKSMKRKMEADMEKSEALLKTLASCRDALVFCCKERLQAVELMNQPLDKVLEQAGRHSWVNISRVPTPRTQGLKTPPPDPVGTYTPECAKALYEAKRLLMESKDTLLDMAKNEEDIREQQQQISDRVCASLAQKMRETLELKDRLNMTLGLMRGTIHRCTKFNQEMYITRGLIKGPLSKSHLETREKLDRPLVRMYQRHVGTQLPEAARLAQGTDKLQRHISHVEKNLDELLSMRKKLTWSFNCKKIGHNVDYSVVRLRLRQRHPQVCYEQAQRLVNDWDPRTPPRVKSNTAITK

Entity 20 Entity 20 polymer

Description description	Protein phosphatase 1 regulatory subunit 32
Molecular weight formula_weight	47818.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS,BT

MMGKLPLGVVSPYVKMSSGGCTDPLKFYATSYCTAYGREDFKPRVGSHRGTGYKSNYRPVVFYQPHLDALDNTATGEQGCNNFQTVTSQSYRPLEVPDGTHPLPWNLHQTNSGYSREKASAVTPIKEVRKVHFDTQDYGPQAITGLEPKDAPLLHQQQNKGSLEWENAGHGPRFMTSEYNSKYLKEPSHQPDLLQKNSVGAKEETGFTEESNKNPIVFQPPSQALPGDPVLLPGRSVTKSDFLPISHPHGDEFLPVLARGSERETGFSRVNERTLNPRVPPPCPEPSSMNHWQFQSPQRMQQTNVALLGRETVGNKEPSGFSLNNPSYVRSPYDPDMDNRYLTTYNQGYFENIPKGLDREGWTRGGLQPQKPGGYALNQPVTRLEATPTPTESLRRLHPHLGRTLISVDPFYRTAPPSGHVSRFTAPN

Entity 21 Entity 21 polymer

Description description	RIB43A-like with coiled-coils protein 2
Molecular weight formula_weight	44773.4 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU,BV,Bi,Bj,Bk

MEVAQPKDLKEDFVLAKRRHAELVRQKRIFNARNRIIGGDTTAWDAQVCDQNIKAATEKARDEAFAAEMRQNDKIACLSENRERRDRKNLCKAINDFQQSFQRPETRREFDLSDPLALKKDRPARQSDYDARNTISGMQKFMGEDLNFHLRKKFQEEQNREWSLQQQKEQMIGRENQKCAEDLYLKTRLQFDETAKHLQNLETATRKAVCATVKEFNKNQALESAEKKIQERKQEQEDNLAEISNMLRGDLLSENPQQAASSFGPHRVVPDRWKGMSQEQLEEIRLVQRQQVQEKLRLQEEERQRDMDWDRRRIQKARATLLFEQQQQRLQRGLRRALDCSNLSLAREQLLQKKHMKELCTNHATEDYFTQFNTGSR

Entity 22 Entity 22 polymer

Description description	Cilia- and flagella-associated protein 107
Molecular weight formula_weight	23271.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW,BX

MQFLTAVSPQSSSTPSWKIETKYSTRVLTGNWTEERRKFIKATEKTPQTIYRKEYVPFPGHRPDQISRWYSKRTVEGLPYKYLITHHQEPSQRYLISTYDDHYNRHNYHPGLPELRTWNRHKLLWLPEKADFPLLGPPTNYGLYEQLKQKWLPPPEATLRESIYTSSYPRPPAGAMSRREHAIPVPPPRLQPVPHF

Entity 23 Entity 23 polymer

Description description	Piercer of microtubule wall 1 protein
Molecular weight formula_weight	15673.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bf,Bg

MSEEDPKACAEPEEPKAGPPPEKTSDWYRVSEDLPARFNNPAWFRGYRTKEPPSVYRTSNQAYGSRAPTVHEMPKVFYPNSYKFSRQVAVGGMFQNNTLNVYMEKSIVTGPDNYITSYDRLNFHPSYRVCRPSICD

Entity 24 Entity 24 polymer

Description description	Piercer of microtubule wall 2 protein
Molecular weight formula_weight	13784.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bh

MTECDWEKKSTSASNSDTEMKPELPPCVNPGNPVFSCMLDPKTLHTTTSLSKPKMIMYKTNSSNYGEFLPMPQFFPCYYTPREQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNFQHTL

Entity 25 Entity 25 polymer

Description description	Stabilizer of axonemal microtubules 1
Molecular weight formula_weight	40613.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bl,Bm,Bn,Bo,Bp

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 26 Entity 26 polymer

Description description	Stabilizer of axonemal microtubules 3
Molecular weight formula_weight	37465.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bq,Bu

MAGRTLALRYGPPWSPISGTEVPGSWPNWHLTSSGVAHHFIPPVSFPPPTVQSTVAEPLPPASKQDLHIWAFDEVISRWETTSGSALVPKTHGGPYAQPKTPEPANPTRAVGIKDLGEKLRHRGWRLPLITKHQCSETKAQYGGWPDLDRGPTSYFGPQPLELADHHRGGPSQALIPWTKNPELAGRPFTISDRGILDRHQLYLTTSARDFRPYSKKESSSYPCKDSMTSNFGETPQAGGHSQKQLPCPSSSRPPQRAKIRLPRGRPVIPVVPHRGALTLAQESYNLPLHPLRRLDRFCPLELPWGGPHWKPVSGIYSVPHAYRTENSNYGSLKPALV

Entity 27 Entity 27 polymer

Description description	Meiosis-specific nuclear structural protein 1
Molecular weight formula_weight	60538.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Br,Bs

MASIRRTLSFSERHQKLVDINYCKKLHVEALQRLQNQTRDQMVQNENDDRAERKRFLRLLQDEQFELDMEEAIQKAEENKRLRELQLAQEEKLATELAKLKRESLKDEKLRQQVRENSAELRELEKKLKAAYMNKERAAQIAEKDAIKYGQMKRDAEIARTMMEEHERLIKEESAAEDKRNQAKAQYSHDLEKQLEEQGKKKQEAYEQLLKEKLMIDEIVRKIYEEDQLERQQRLEKMNTTRRYIEEFQKEQALWRKKKREEMEEENRKIIEFAKLQQQREEDRMAKVQEKVKKKRLQLKNMLTQRLEEMLRQREDLEQVRQELYQEEQAEIYKKKLEEEAEEKLRKQKELKQDFMDQMALKELILQAAKEEEETFRKAMLAKFAEDDRIELMNAQKPRMKQLEHKRAVEKLIEERRNQFLADKQRELEEWQWQQRRQGCINAIVEEERLKLLKEHATKLLGYLPKGVFKNEDDIDMLGEEFRKAYQKRSEICEK

Entity 28 Entity 28 polymer

Description description	Tektin-3
Molecular weight formula_weight	56760.9 kDa
Source method src_method	nat
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C0,C2,C3,C4,C5,C6,C7,C8,C9,DO,F2,F3,F4,F5,F6

MELLGSTLTATYAHPRPTPTNFLPAISTMASTYRDRFPHYNLTHSLSLPWRPSTYYKAASNWPTLDPYCTRSQRVSESTMLPFVSNRTTLFTRYTPDDWYRSNLTNFQESNTSRHNSERLRVDTSRLIQDKYQQTRKTQADSTQNLGERVNDIGFWKSEIIHELDAMIGETNELTDIKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEKELLTEVDTILCCQERMKLYLDKAIAQLAANRAAQHELEKDLSDKQSAYRIDDKCHHLRNTSDGVSYFHGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIQNVLVVTANEMWNQFNKVNLAFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIVEKSAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVYEVDDTIQTLQQRLRDAEDTLQSLAHTKATLEHDLAVKANSLYIDQDKCMSMRRSFPSTLRLVGFC

Entity 29 Entity 29 polymer

Description description	Tektin-5
Molecular weight formula_weight	56564.8 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1,Cz,D0,D1,D2,D3,D4,D5,D6,D7,D8,D9,DP,DQ,DR,DS,DT,DU,DV,DW,DX,EA,EO,EP,EQ,ER

MEFLGTTQTATYCGPKKPCGGSVLPSVASGPTVQECYQPYYLPGYRYLNAWRPSLFYKVANAQTCLDEGATCRSALRPPTILPAVRSALFCRYSPQDWDQSNRLQLCGAEASRLWAGRMTGDSMRLMQDKDQLTRQMQEGTCRNLGQRLSDIGFWKSELNYELERLLNENHSLDAIKRRLECAAEELRCPLQVALECLYQREKRIGIDLVHDNVEKNLIREVDMIKCCQEQMRKLAQRIDIQMRDNRDAQHALERDLEDKNSAEFIDEKCLNLRNTSDCISFFHGVEKIDGTISVPETWAKFSNDNIRHSQNMRANSIRLREEAQNLFDVLADQLWRQFTNTNLAFNARIAEETDVKNKLQTQLAKTLQEIFQTENTIMLLERSIMAKECPLKVAQTRLECRTRRPNVELCRDSPQFKLVNEVFTIDDTLQTLKLRLRETRDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMAMRKTFPSTPCMGICP

Entity 30 Entity 30 polymer

Description description	Sperm-associated antigen 8
Molecular weight formula_weight	51604.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CW

METSESTDRSQSRCLDLQPSSDGLGSSSDPFSSWDGRHRSALVAATAAASAAATAASTARAAALWTKSPAPYSHGNLLTEPSSDSLTERYTGPRFTHKISHGRLGFQPAYFSHIAWNPYTTNDLSSSRGPIPGSSSGPVPGSSSSPGPDSSSDPGPSSSSGPGGSPGGSGRGPGHGPGPGGGSGQGPGGGSGQGTDLGPAIDSRHSPGHGHGPRFNFSAPVGFRNPRGDLIPNYTGCKHHCHWEPQKQSWKFLKVSEPGARGLWKPPEVEGKSTVLSETLPRGQCLLYNWEEERATNYLDQVPVMQDGSESFFFRHGHRGLLTLQPQSPTSSCTTQKDSYQPPKSHCQPIRGKREAILEMLLRQQICKEVQAEQEPTRKDSEVESVTHHDYKKELVQAGPPAPTKIHDYHTEQPETFWLERAPQLPGVSNIRTLDTPFRKNCSFSTPVPLSLEQPLPFEPESYSQHGEISSLACQGGGQGGGGG

Entity 31 Entity 31 polymer

Description description	Spermatogenesis-associated protein 48
Molecular weight formula_weight	49735.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Cl

MDTYSQLIPGKISISEGSFLSRTKAVENIDYPHYCALLRKLNMPFVKGVEDRHDYGRMEKKCNPTFLKFHPYPPSVLPDYHLHYPYPPPYGPDYPLFPLRDDVPLQDPCSGFLSPGGDADLKPGVGRTIPSLVDFSDVKPQHRVPRPDTGFQTTLKRKTILLEELKQDRRWNSRAVPDISIRARLGGWTSPLKVTPSQPHHGEHSINHPYIFDEEATCTDNGEPVLQSNKKYSAKDSFYKSSTQKAYEMVPWDKMLPPKLDPEETTVEKAADPVSHCFTLKRYEGLPAITQMVGGLWDRFQTRSFLAPVKPVNFVSPSSRSKYIPLYTGCVQSTNADDIDNPCGDITSLAKPRSSEILYTNSSRSANIPGYTGKVHFTATHPANSDRPSTTPSPDSEVHHVLRKRMAVDLFRHQGPLSRMVTTVTPYNPFNKKDKETISY

Entity 32 Entity 32 polymer

Description description	Tektin-1
Molecular weight formula_weight	48798.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Cm,Cn,Co,Cp

MAKLLQQPPKFLRAEWQIANKNQYHRAEAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVYATEDLLLYQTRLQKALESFKEPLHITEKCLEYREKRVGIDLVHDEVEQELIKEHEIIRGVMTLLTRTLEETCEQIRLNRSAKYNLEKDLRDKFTAITIDDICFSLNNNSPNIKYSENVVRVEPNSVSLEDWLDFSNTNVEKADKQRNNSLTLKALVDRILFQTASDLRRQCDVVDTAFKNGLKETKDARDKLALHLDKVMEEIASQEKNIVVLEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLIKEVDEITHNVARLKETLAQAHVELKGLNRRQLALQEEIQIKENTIYIDEVLCVPMRKSIPPRDGDDHGEWAGGSHPEAVC

Entity 33 Entity 33 polymer

Description description	Tektin-2
Molecular weight formula_weight	49962.7 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Cq,Cr,Cs,Ct,Cu,Cv,Cw,Cx,Cy

MATLSVKPSPRFRLPDWQTNSYLLSTNAERQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLAERIDTVSRWKEMLDKCLTDLDAEIDALAQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEEELHKEVEVIEATKKALQQKISQAFEKLFLLQEARQRLNSDHRGKMETLDIDRGCLSLNLTSPNISLKINPTRVPNGSTSLQQWDDLSRFNKDHGEAEMKKAIELREAIALTIAETNNELEAQRVATEFAFRKRLREMEKLYSELKWQEKNTLEEIAELHEDIRHLEEDLRRKLQNLKLCHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALYKHLARLQADIACKANSMLLDTKCMDTRRKLTVPAEKFVPEVDTFTRTTNRTLSPLKTCQLELA

Entity 34 Entity 34 polymer

Description description	Uncharacterized protein C1orf100 homolog
Molecular weight formula_weight	16642.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTAIRLREFIDRRPAIPPSIFIVHQGKDLRGYYTGQLARVHYDYSVKRSPRPLIDLDIPFKKKSQYQPQLDQQTLIQYICFRRRSKPAEPWYKETSYQRDYSLPFYKTDWDRKLATVSSNPRPLNSLPEHYCCEGRWL

Entity 35 Entity 35 polymer

Description description	TEPP protein
Molecular weight formula_weight	24939.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DY,DZ,Da,Ee

MARIIDLVPWEDGSTHVYASPAILLPIPRRRNQLAGVKQQLYHPALPSLRRMDMDSVKACLSDEHCQSTTYCRKDDFDNAYFTLLGVPNKPLQCLDITETGQRLRNRYHEGKLAPIAPGINRVDWPCFTRAIEDWSRFVSSAGEFKLPCASKKVESFSGYAVRYLKPEVTQSWRFCLNQNPSLDRYGQKPLPFDSLNAFRRFGSNYSRVNYLTPWH

Entity 36 Entity 36 polymer

Description description	Uncharacterized protein MGC137036
Molecular weight formula_weight	21238.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Db,Dc,Dd

MLLAEEFAESALHRRVLFHAAAGRAGAEGGPSLPRLPCSGLDSAPSPRGPLPGHAPRRPPRPRTGRQVLGAPPLSEKCELPGQDSQKSSVPSHGPKTPSGQKVKAPHRPLSLSWKQDREQTLAAAYVPVVVDPRGQNPEKLRFNFYTSQYSNSLNPFYTLQKPTCGYLYRRDTDHTRKRFDVPPANLVLWRS

Entity 37 Entity 37 polymer

Description description	Testis expressed 33
Molecular weight formula_weight	30322.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	De

MELGHRPGTTTLTRAHPNNNKEGQQDTDPWRAAHSPLDTSKLKYQAPVSVKPSLYRGDSPRSSSLGRASLEEIPPPPPSAVSRGSLWRDSDPESLKKGSFRPSSRESRASLREGAQPCQAPKEDPNAGAQGQSGSSIPNNIRHKFGSNVVDQLVSEEQARKAIGEALEGQKRTSSWPSRIQSPTEITSIFSDYYDLGYNMRSNLFQGAPQETKSLMKASYTPEVIEKSVRDLEHWHGRKTDDLGRWHQKNAMNMNLQKALDEKEKSKNKNSK

Entity 38 Entity 38 polymer

Description description	Testis-expressed sequence 37 protein
Molecular weight formula_weight	20375.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Df,Dg,Dh

MSGVVFPGQAPVDLDIYQSSYMIDYRPYGKHKYARVTSEEQAKLDTQLQDKEFYRPTPSPNPKLEDGYPAFKRPHMTAKDLGQPGFFPPQGRVGPVEDEWRFTSTCPSVYPASHALYLAHGDPNRIQQSADFPCLLEPEHQPAPDVGKGYFLLPGCACTYHCTVKVPILNRWGPLMPFYQ

Entity 39 Entity 39 polymer

Description description	Testis-expressed protein 43
Molecular weight formula_weight	15209.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Di,Dj,Dk,Dl

MASGKDTCPILPKLTNNCSDENSDKLANKCEIHLPRFSLKQGMIPRHYVMPWKQNMKFRNVNLKHAEACGIHAGPLEDSLFLDHSERLCHGEDRKVVLKKGPPEIKIADMPLHSPLSRYQSTVISHGFRRRLI

Entity 40 Entity 40 polymer

Description description	Testis expressed 49
Molecular weight formula_weight	15441.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Dm

MAFFNLHLLGYQNSFRSKKRDKTEETNQKDPVPTRLPPIFSEDGNYSVHQNSHTKYHEAVRKVSLKTFPNQVFRVPLTDAQNFSFWRSNAAGARPEETMPWIQNPRHCLIKSAMTRFMDHSILNDRNFSLY

Entity 41 Entity 41 polymer

Description description	Theg spermatid protein like
Molecular weight formula_weight	50941.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Dn

MESQEFSGPSGLSDGHHTAETSARSEALQKPLVRIFDMNKQLEESEEAGFSEESEEIPNHPKAYELYQSYESHKPLKPHAPYEPHAPREVRKPREPRKPRGPPVPREPHKSQEIELLPRAGVMVSPSLLMRLPPRIPPSSLSGRCWGLSGALSNPTPSRPGGSNGKVCLSFSRKRIQDLSRPKKQWRAPDRKLFWGNQDPIRPVSRNALKAQMTQRLENLAQSKEVSHRYVPNRVQYYYSCGRESVIWEIPSPALFCQPSKRIQKLAQPNRSKRGDYLIRGSLQFSDPSPRILRLSIAKATNPNYVPPKSIETKILSSTLTAIAAPRIVDLAHPRIKIEGLCFERERSEKPIRPISHAALLAHPSPRILALAKAKPLHKDYLPPRDALWPVSYAAIHSKISPRIQELANPNTRTPVHIVYYDPEVFKVKPAALKTQCSPRIQELAEPITR

Entity 42 Entity 42 polymer

Description description	EF-hand domain-containing family member B
Molecular weight formula_weight	97960.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MCSFLRVPSPKGLEPSKGLGAPLQPGTAYPSEMSALGPGMTVSGRKSPLSMEVGLAPEGKDDLEERRVFMGTTSPTELGLRVGLRKDFPCSKTYEERMASPEIRSPSSKGLELRLKRQNISRTVMDGSNLGVHRVSASQETKPPLSALPGRVGLEKERFLAGYCPGRVTQPPLGQGCESPQASGGRRCPVTGDPEGFGASVSKLPALGMECRGELGGESACVVMKPRAETEPPVEVDMGLTRLEEPAEMESPEPQMGLVMEPPAWQLAQQPEEQREAENTEPGVEPPDRIRPIYSGKFFDRMPCWPSAGKVLPIGYRAATCLTERFPRLMTPPEAKKFFNFRYPPAGAERVFYGRANDPQIAPSLTHGIRSKISIPAKVLINPQPITTFQQKMKDKKESVYFSNQRAPLGKSHDQTPGLPKGLDILNTTFGTAIVRETSARDMVNPPKPYKEVFEEAQAGHDLYVVSHNDYFVGEAKNRKYDPSSFHRFNLYGIPTPHFNDGRNMAKTLHWLHELQMKRGAKIVSKRVDDFKEKFQHRLGRVLDPIAETMNVPPDYTFGAFLRPEDYGVGDLIHRRLPGEYLRGKDRQRGLVAAVRHHLKKVNYQNFDTLLAAFRHYDKKGDGVIDRAELQEACDQACLHLDEKLLDQLFEYCDVDKDGLINYLEFANFLTWKDKTPLKEYEERVLIKGRKADCANPAEANVEESEPALLLKPEDIVLKEPGSSEKTLRTLLRPSDKVSNHYKTTSSEISAVVGAVPSTCYPTYGVPTIRSDIPAPLIRRVSDRTSYGEEGNAYSLLHPTIFAQKGVFERDFFKTRSKQEISEILCNIGVKLSEDEFENVWNLASKKHHRGEVCVENIRSVLDELQHADGAKCKAAT

Entity 43 Entity 43 polymer

Description description	Tektin bundle interacting protein 1
Molecular weight formula_weight	24559.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E1,E2,E3,E4

MQTLRRQAAWPCVPRGTLEVDFPPPLYSDDYLSQEGPRWTPAIKQATRWKYTPMGRDAAGQLWYTGLTNSDSREAWYTLPRAPDSPYREAYARWHGCYGHRERSLPSAYTQRLRETAWYDPIIPAQYTDPSTRWGSVLWKDRPIRGKEFAINRHRFGVEPLWRASDYVRYLSAPQRPRYTAQNYRQWGLEPYCPATNQRPPPVYTPSH

Entity 44 Entity 44 polymer

Description description	Tektin-4
Molecular weight formula_weight	52025.5 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ES,ET,EU,EV,EW,EX,EY,EZ

MAQTDILLTKEPAPQTVPACQLPRKLYDVARNTGAHTSSGLATSGFRTAKYLLDEWFQNCYARYHQAFADRDQSERQRHESQQLAAETEALAQRTQQDSTRKVGERLQDMHGWKSELQRQVEELVSETELLLAQKQRLERALDATAGPFSIVTDNLQCRERRQHPDLVRDCVEIELLKEAELIRNIQELLKRTIKQAVSQIRLNWEHKETCEMDWSDKVEAYNIDEACCRYNNQSTDVQFYPHSAKFEESASTPETWAKFTQEHLYRAERERLASVNLRNLIDCILQDTSEDLRLQCDAVNLAFGRRCEELEDARHKLEHHLRKTLREISDQEHNIAALKQAIKDKEAPLKVAQTRLYQRSHRPNVELCRDAAQFRLASEVEELNLSLAALKEKLLEAEQSLRNLEDTRMSLEKDIAIKTNSLFIDRHKCMAHRAHYPTVLQLAGYQ

Entity 45 Entity 45 polymer

Description description	Chromosome 7 open reading frame 31
Molecular weight formula_weight	67685.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MEVIHGQPYCCRELEGADILSDTFYSNELHTPLETATRPTASEDRYQKFRQSLQRCRLPWGAEREYGGMIPISLPEEHRPKCEPPRVMGKGHQHYGFGGEIWPRKLPIEQFYYLSQNKKSDIYGNDSLLPKPPNSTVGEICSPYPIEHPYHTHISRGAMFPTFTSPKDLYTGIKARTQQPFPPTVPTKPYDTTVLKTRGNPYRYELLDFPMDSKKKALVWPGQRVYFDLPKCVEKNKPVFYPKPPKTFAPNTSLNSWDPITSLKEVNIQRNLEKSHWITSYNHDFTGLGPMNPLELDDYHEKEVAELTGQIGFDPEPQEKVHPALKPTRPLEGRIARLIQNQRPLEAILEQRPSSCPDCTPRVLCTFHTFVPSSTEMMALSDNIPADVTHKNQEIEEKIKEEQSLLSTYALPSCYPTKDLANTYDIKPFPKITDTKKTEDLYWRQLSLKPQLIPYCNPDHYIPYEHLNQYNVYQNPVSLSKPGILQSKPDLKTFDFEHFLSKPEQLTLNMEDDEETKPILGWIPRAGVAKPQTDLLELKNAFSKTGAQKRFHKSVLEDYKDLRDKEHLGKKHQFYGHNSYYFYN

Entity 46 Entity 46 polymer

Description description	Cilia- and flagella- associated protein 210
Molecular weight formula_weight	65437.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,o

MLVRFGRRSGQAKESAEMKNCEEDPVLYPPLLPTKVDLRQVTIIPHNEWERIRDSLDSLTREAACLRAERKAKKEMHLRSQEVVKHWTNTYAGMKEQKLEAKKKRDEEIEAERQILDIEEAIYKQGERKKAIELAKQYQFYQTERVKNFHSGLLLSRVMKERDAQIEFQKSKIKSDKKWEEQVKLNVEKAFKEEREKAEKQRRERVALAKDHLKQIKEHEEEEERRRKEEEKDAEEIKRQNSLYEIEMKKKQGKKKEEINESRRLFFEHLNDKHIIKAVEQQQQEEEDEKIRKFIKAKKRLTQMGKEKEAETHRLMEERRKRINNFLSKLMKEKFDNEDLIIARDIAEAEAEWEKREREKYEKNKAELKAIAEHRALVMKNKEEEERQRKIEATEQMLAILKADQIFWEHEKEKKQKADKERREVQDAHIQQMAKHKFNALQAKQAESEYCRLTEALVAEKEKEFQDYAREVIESESESTKKYIYPLVKAVQEGPGGGRGPVLVDRGGLRPSYQANDTTGVQLPFYNSPGSKYNNFQKSKGRLGFTW

Entity 47 Entity 47 polymer

Description description	EF-hand domain-containing protein 1
Molecular weight formula_weight	74125.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,X,Y

MVSNPVHGLPFLPGTSFKDLTKTAFHRSQTLGYRNGYAVVRRPTVGIGGDRLQVNQLSQADLDELASKIPILTYGQARQAPPAAFVPAHVAFDKKVLKFDAYFQEDVPMSIEEHYRIRQVHIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRLSKNDRGDHYHWKDLNRGINITIYGKTFRIVDCDKFTQVFLESQGIELNPPEKMALDPYTELRKQPLRKYVTPTDFDQLKQFLTFDKQVLRFYAIWDDTDSMFGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRMPKVLVENAKNFPRCVLEISDKEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQYYQEKFGISDLPRIDMSKKEPPPMKQELPPYNGFGLIEDSAQNCFALIPKAPQKDVIKMLMNENKVLRYLATLESPFPEDKGRRFVLSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPGSSVENPVYYGPSDFFIGAVIEVFGHRFVILDTDDYVLKYMESNAAQYSPEALLSIQNHIRKQEAPAPELDGQQAEEDPGVRDLEALIDTIQKQLKDRPCRDNIREAFQIYDKEASGYVDRETFFKICGSYQLPVDDSLIKELIRMCSHGEDKIDYYNFVRAFSN

Entity 48 Entity 48 polymer

Description description	Uncharacterized protein C10orf82 homolog
Molecular weight formula_weight	26677.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K,L,M

MESSKTFMRQMPITPGYSGFVPYLSCQGTSSEDNMANCLKIFQENTRRCKDQLEEFHCSVATAPKLKPVRSEGTVLRTLHQYYRQYHPLSLECKNIKKPLHEPPIPGWAGYLPRARVTELGCSTRYTVMARNCYRDFLDLMERAKQAHLKPYEKIYGVKSTPPPPTPPPKVLLHEGLLPKYPDFSIPGARCPTLSRALMEDPRPLMTCGCPQRPSVWCSGKIYLEPLSGGKDMEG

Entity 49 Entity 49 polymer

Description description	Cilia- and flagella-associated protein 144
Molecular weight formula_weight	16178.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K1

MAGHQKEKAIADEVHQNQILRELYLKELRTQKLYTQYHVNPLRKVHTIARKPMSWHDNLEEPADARFLNLIHHAAQGPRKKYPETQTEGQEIGWDSEPLVNPQRDDRRLNHFRVYKDITLYKAKMWSLGEDDRHK

Entity 50 Entity 50 polymer

Description description	Chromosome 20 C5orf49 homolog
Molecular weight formula_weight	16820.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L1,L2

MEDDEEEITAAALRGKPRPLPISALSAFSYIPPRRQDPKEHSYYYRQGWTGIISLYDCVFKRDPGYNQKLHRDDREHAKSLGLRINEEECERPVGVLSSSVYGRRIDQPVEPLNRDHGRAGHVKADFYRKNDITSIKAPGFGHISPA

Entity 51 Entity 51 polymer

Description description	Chromosome 19 C17orf98 homolog
Molecular weight formula_weight	17813.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,O

MAHLCACPLRREKGFILDGVAVSTMARSYEHLRPKLWSAIPPYNAQQDCHSRRYFRSRVVPPILRETDQDHGGTGRDGWIVDYFHIFGQGQRYLNRRNWAGAGHSLQQVTGHDHYNTNLKAIQGFNGRFGYRRNTPALRHCPSVFGEITRFPLF

Entity 52 Entity 52 polymer

Description description	Chromosome 13 C20orf85 homolog
Molecular weight formula_weight	15810.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAQKPISTAAAERMNLVAQDEIWKYRLKAENEARQNWAQNWGFLSTPFEELIKCEEEPATPKPKIELPERFRIRPVTPVEKYIKVLPSPPVPKTTQGFIGWRSGVPGLNKCLEHDYEIRSCKGAYAKELNWPKQGIH

Entity 53 Entity 53 polymer

Description description	Cilia- and flagella-associated protein 68
Molecular weight formula_weight	20163.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MTATDYHCYSEFFQRQVLACFLTNPHYGSLINADGHAEVWTDWNDMSKFFQYGWRCNTNEDAYSNRTLMGNWNQERYDLKNIVQPKPLPSQFGHYFETTYDTSYNNRRPLSTHRFKREPHWFPGHQPELVPPPYKCTEKSTYMTSYSKPQTDHHSVCVWNPSNCQFQSP

Entity 54 Entity 54 polymer

Description description	Cilia and flagella associated protein 77
Molecular weight formula_weight	32999.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,S,T,U

MPEARNSCQDLTRWKKKKPPVRRTVSQICPPPRRPLTVADIRPGMENERLGVVRDSMFQNPLIVKAELGKPRERSCSLPGINFNYGLYIRGLDGGVPEAIGHWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENLHYRQLNDIRISDQDDRRLKKEPPSLPPNMTFGIRARPSTPFFDLLQHRYQQLWVQEQKDTQKAIKLEKKHKVILGKLYETRSSQLRKYKPPMGLDTLWHMPHFQKVGPHLATFPTEADRQRAFKAHREECAVRQGTLRMGNYTHP

Entity 55 Entity 55 polymer

Description description	UPF0602 protein C4orf47 homolog
Molecular weight formula_weight	34554.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MPAEGGKTDMERIGLFSEMEYITVGDKYVSQFNRPFNESASKNRQILPGGSKEMSNLQAGYFDPHFVRIFEGESYVNPNQVRRRYMMEEAKKNLSKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPKEKYEPPGKNLYTNPGKKGTGYGYANITIGKQFSHSSDLYDAAKLNNKKENEEHRRLLKGTAFKLNLYPREYFDTNPYMSEKPLPPIKKVEKKETVGNPFKPSSPGKKAGGMKAGTFDPYPSHSADPYVVKLKSPSSKSAKVFHPPGGPKSRPIESIMALNVKRALNMKNYKTASVQSY

Entity 56 Entity 56 polymer

Description description	Cilia- and flagella-associated protein 20
Molecular weight formula_weight	22781.4 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	XG,XH,XI,XJ,XK,XL,XM

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Entity 57 Entity 57 polymer

Description description	Parkin coregulated gene protein
Molecular weight formula_weight	29323.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	YG,YH,YI,YJ,YK,YL

MVAEKETLSLNKCPAKLPTRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPSAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGEALVPYYRQILPILNIFKNKNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVPTYESCLLN

Entity 58 Entity 58 polymer

Description description	CFAP97 domain containing 1
Molecular weight formula_weight	19600.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,p,q

MNNSLDYLAYPVIVSNHRQSTSFRKKLDFGHYAFHKNRIQIVKPTVDTKPPAAHTHHILKLSKLQGEQKRIDKIEYENKQLCQKIANAHRGPAKVDCWNEYFSKSLNRETRNRELVRITVENQGILKRLGDRKPHYDRKSSELDWQNSRRYIRNTTRYLLSRDK

Entity 59 Entity 59 polymer

Description description	Cilia- and flagella-associated protein 45
Molecular weight formula_weight	65800.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d

MPLSTAGVLSSASTASNRSRNRPRYRTKALSSEVDESLFGAIKPLTRSDSPIVLLRDKHAIRKTLTALGLDHKPETIQLITRDMVRELIIPTKDPSGQSLIMSPEEFERIKWASHVLTKEELEAREQAFKKEKEAIVDTVTTRKKIMKQKEMVWRNNRKLSDLEEVAKERAQNLLQRANQLRMEQEEELKDMKKIILNAKCHAIRDAQILEKQLIQKELDAEEKRLDQMMEVERQKSVQRQEELDRKRREERIRGRRHIVEQMEKNQEERSLLAEQREQEKEQMLEYMEKLQEEDLRDLEQRHQQKLKMQAEIKRINDENQRQKAELLAQEKLADQMVMEFTKKKMAREAEFEAEQERIRREKEKEIARLRAMQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENAQKKMETEAKLRKSRLEQVAFKEHTLAVQVQRDRDEFERILRAQREQIEKERLEEEKKATGRLQHANELRRQVRENQQKQVQARIATFDEGRRLKEEAQKRRERIEDIKRKKLEELRATGLPEKYCIEAERKANIPVNTSVN

Entity 60 Entity 60 polymer

Description description	Cilia- and flagella-associated protein 52
Molecular weight formula_weight	68719.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,g

METQASPKDEVAEAVELELEAVIGFNGHVPTGLKCHPDQEHLVYPLGCTILIQAINTQEQNFLHGHGNNVSCVAISKSGLYIASGQVTFMGFKADIILWDYKKRELMARLSLHKGKIEALAFSPNDMYLVSLGGPDDGSVVVWSIAKREAICGSPAAGLNVGNATTVIFSKCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVMSISMANDDSFFYLGTTTGDILKMNPRTKLLADTGPAKDKFSLGVSAICCLKMGGLLVGSGDGLLVFCKSPSYKPIKKIQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTNFKETLITTCHFESVEDIVFPFGTAELFATCAKKDIRVWHTLTNRELLRITVPNMTCHGIDFMRDGKSIISAWDDGRIRAFAPETGRLMYVINNAHRIGVTAIATTSDCKRVISGGGEGEVRVWHIGHQTQKLEEALKEHKSSVSCIRVKKSNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELDGSLSGAVNGMDITVEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWKYPFPS

Entity 61 Entity 61 polymer

Description description	Cilia- and flagella-associated protein 141
Molecular weight formula_weight	12361.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MSMEKMGKVEEHFQRALELKKMVHRWRNSHTHCLWQITLSQRRNPYAILRMQDTMVQELALANKQLLMVRQAALHQLFEKEHQQYQQELNEKGKAFYMERL

Entity 62 Entity 62 polymer

Description description	Cilia- and flagella-associated protein 161
Molecular weight formula_weight	36519.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,j

MAQNLYGPRVRIGNWNEDVYLEEEIMKDFLAKRDKGQLLIQRNRRLKENLLRPMQLSVSEDGYIHYGDKVMLVSPDHPETEADLFLPGDLSLCMTPDEIKAHLSNELEVPCGLSAAQTKIPVGRNTFTILCAAGEVIGQVLRYGQNFRLGITGGFDDRMLYLSSDHRTLLKSSKRSWLQEVFLTHEDSYLNCWQAAFPHPQLRLEYEGSPVPANTKILITHCHTNRGLVAHRHLFLRTYFGQEAEVAAHTYLDSHRVEKPKNHWMLVTGAPRKDLSTMLDLPKPPAEDTRALEQEREQVSDPGARSTPDARGCVPQCTLPM

Entity 63 Entity 63 polymer

Description description	Dual specificity phosphatase 21
Molecular weight formula_weight	22075.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,l,m,n

MTTPLCPFPIQAVRQPAAHGLSQITKSLYLSDAVAAKDKAMLSTNHITTVINVSMEATDTFLEDIQYVKVPLADAPNSRLYDFFDFIADHIHSVEMKQGRTLLHCAAGVSRSATFCLAYLMKYHSMSLLDAHTWTKSCRPTIRPNNGFWEQLIYYEFKLFSKNTVHMISSSMGMIPDVYEKEICLMTLMGVIPDSS

Entity 64 Entity 64 polymer

Description description	Uncharacterized protein C4orf45 homolog
Molecular weight formula_weight	22640.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ke

MACVTFREPISATVGKRMVFTGPAYVKDHLPQVAQHTAYIGEKRPALEKTGDLRYLWRPASNRSLPAKYKPEYVGEIGWGIPEYDFINKTRLQTGFHIKYEEFSQAAIDKLSHRYQSPWQPNPSIMDAEGSSSRGFIAWHMGDYEDTSQRNSKRAVLLRQSKAALPIGSRPPKLPKLPKKEEKSKFRPLHQHDARCY

Entity 65 Entity 65 polymer

Description description	Cilia- and flagella-associated protein 276
Molecular weight formula_weight	19387.8 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r,s,t

MPLTRDPFQNPALDKDDSYLGKSRASKKLPYKNPTHLAQQQEPWCRLSSTPTITSMKRDGFFFYSEIPKDDLDFRLAALYNHHTGTFKNKSEILTHQETIQDTRRIKTQFPGEFLPAPQPPLITSRANIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFST

Entity 66 Entity 66 polymer

Description description	EF-hand calcium-binding domain-containing protein 3
Molecular weight formula_weight	50208.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u,v,w

MAVSEIKAKFKLNPLTKVPNFHSRRDKDLPGLLPCQLQHKERKLSPSQMRAFQDAYNFFNKDKTGCIDLHGMMCTLAKLGMNLTKHDVHNELRCADIDQDGKVNFSDFLKVLTDKNRFLKAVVPEKGTCLDLAGNPGILLFEILSKLIETSALPKKAISEIVSYFRRKFQETTSGMVWSPDTTGYGKRRFKPDICTPPSSSTAAFANAARIAIMKEKDLFKFLDELKKCNPPSDSPYSKIPIFPLFPNVDGVVMGKPFKDIQKLEMLKRKEPLNFFENYFFHKKDWKTQAANIKPVDPTSGYSTDILTIDQMLKRKQNWTVADAAAIKPHVKRATETYNLGIALEHRKQMLNLWRKIRGDLIGIESKNESFYDTFSTYTWSWNVCQELLSPKDLKLYDAHVNRNALHNSVFSSSSDISECDTDTGRKRKRKGFKGFRQ

Entity 67 Entity 67 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	149

Entity 68 Entity 68 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	149

Entity 69 Entity 69 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	153

▶

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	34083

48-nm repeat of the native axonemal doublet microtubule from bovine sperm

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cilia- and flagella-associated protein 95

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sperm acrosome associated 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Testis specific serine kinase 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EF-hand domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP6V1F neighbor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Outer dense fiber of sperm tails 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha-3 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-4B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cilia- and flagella-associated protein 53

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoside diphosphate kinase 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer