9cpb

Atomic model of bovine Fallopian tube cilia doublet microtubule (48-nm periodicity)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Armadillo repeat containing 4

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1B8W3_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1A； PDBConstruct 1–1044； UniProt 1–1044

Coiled-coil domain containing 114

OrganismNot specified

UniProt F1N2N9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1N2N9_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1D； PDBConstruct 1–687； UniProt 1–687 Author chain 1E； PDBConstruct 1–687； UniProt 1–687 Author chain 1F； PDBConstruct 1–687； UniProt 1–687

Coiled-coil domain containing 173

OrganismNot specified

UniProt E1BJL9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1BJL9_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 1H； PDBConstruct 1–547； UniProt 1–547 Author chain 1I； PDBConstruct 1–547； UniProt 1–547

Uncharacterized protein C1orf158 homolog

OrganismNot specified

UniProt Q2TA11

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CA158_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 1K； PDBConstruct 1–196； UniProt 1–196 Author chain 1L； PDBConstruct 1–196； UniProt 1–196

Protein Flattop

OrganismNot specified

UniProt Q3SZT6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLTOP_BOVIN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 1N； PDBConstruct 1–196； UniProt 1–196 Author chain 1O； PDBConstruct 1–196； UniProt 1–196 Author chain 1P； PDBConstruct 1–196； UniProt 1–196

CFAP141

OrganismNot specified

UniProt Q32L75

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CA189_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 1R； PDBConstruct 1–101； UniProt 1–101

Cilia and flagella associated protein 161

OrganismNot specified

UniProt F6RJC2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F6RJC2_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 1T； PDBConstruct 1–321； UniProt 1–321 Author chain 1U； PDBConstruct 1–321； UniProt 1–321

Cilia- and flagella-associated protein 20

OrganismNot specified

UniProt Q6B857

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA20_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 1W； PDBConstruct 1–193； UniProt 1–193 Author chain 1X； PDBConstruct 1–193； UniProt 1–193 Author chain 1Y； PDBConstruct 1–193； UniProt 1–193 Author chain 1Z； PDBConstruct 1–193； UniProt 1–193 Author chain 2A； PDBConstruct 1–193； UniProt 1–193 Author chain 2B； PDBConstruct 1–193； UniProt 1–193

EF-hand domain family member B

OrganismNot specified

UniProt F1MMV1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1MMV1_BOVIN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 2D； PDBConstruct 1–877； UniProt 1–877 Author chain 2E； PDBConstruct 1–877； UniProt 1–877

CFAP276

OrganismNot specified

UniProt E1B9I5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1B9I5_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 2F； PDBConstruct 1–170； UniProt 1–170 Author chain 2G； PDBConstruct 1–170； UniProt 1–170 Author chain 2H； PDBConstruct 1–170； UniProt 1–170

Cilia and flagella associated protein 45

OrganismNot specified

UniProt Q32LN4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q32LN4_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 2J； PDBConstruct 1–549； UniProt 1–549 Author chain 2K； PDBConstruct 1–549； UniProt 1–549 Author chain 2L； PDBConstruct 1–549； UniProt 1–549 Author chain 2M； PDBConstruct 1–549； UniProt 1–549

Cilia and flagella associated protein 52

OrganismNot specified

UniProt E1BKF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1BKF9_BOVIN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 2O； PDBConstruct 1–623； UniProt 1–623 Author chain 2P； PDBConstruct 1–623； UniProt 1–623 Author chain 2Q； PDBConstruct 1–623； UniProt 1–623

Methyl-CpG binding domain protein 1

OrganismNot specified

UniProt F1N7G5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1N7G5_BOVIN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 2S； PDBConstruct 1–514； UniProt 1–514 Author chain 2T； PDBConstruct 1–514； UniProt 1–514

Cilia and flagella associated protein 77

OrganismNot specified

UniProt A0A3Q1LJD6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1LJD6_BOVIN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 2V； PDBConstruct 1–284； UniProt 1–284 Author chain 2W； PDBConstruct 1–284； UniProt 1–284 Author chain 2X； PDBConstruct 1–284； UniProt 1–284 Author chain 2Y； PDBConstruct 1–284； UniProt 1–284

CFAP95

OrganismNot specified

UniProt Q32L77

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CI135_BOVIN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 3A； PDBConstruct 1–232； UniProt 1–232

Cilia-and flagella-associated protein 96

OrganismNot specified

UniProt F1N3A8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1N3A8_BOVIN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 3C； PDBConstruct 1–309； UniProt 1–309 Author chain 3D； PDBConstruct 1–309； UniProt 1–309

EF-hand calcium-binding domain-containing protein 1

OrganismNot specified

UniProt Q32L26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFCB1_BOVIN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 3F； PDBConstruct 1–212； UniProt 1–212

EF-hand calcium binding domain 6

OrganismNot specified

UniProt A0AAA9SGY2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0AAA9SGY2_BOVIN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 3H； PDBConstruct 1–1410； UniProt 88–1497

EF-hand domain containing 1

OrganismNot specified

UniProt E1BKH1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1BKH1_BOVIN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 3J； PDBConstruct 1–640； UniProt 1–640 Author chain 3K； PDBConstruct 1–640； UniProt 1–640 Author chain 3L； PDBConstruct 1–640； UniProt 1–640

EFHC2

OrganismNot specified

UniProt A0A3Q1N1R0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1N1R0_BOVIN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 3N； PDBConstruct 1–733； UniProt 1–733 Author chain 3O； PDBConstruct 1–733； UniProt 1–733 Author chain 3P； PDBConstruct 1–733； UniProt 1–733 Author chain 3Q； PDBConstruct 1–733； UniProt 1–733

Enkurin, TRPC channel interacting protein

OrganismNot specified

UniProt E1B836

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1B836_BOVIN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain 3S； PDBConstruct 1–259； UniProt 1–259 Author chain 3T； PDBConstruct 1–259； UniProt 1–259 Author chain 3U； PDBConstruct 1–259； UniProt 1–259 Author chain 3V； PDBConstruct 1–259； UniProt 1–259

Protein FAM166B

OrganismNot specified

UniProt Q2TBR5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F166B_BOVIN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain 3X； PDBConstruct 1–274； UniProt 1–274 Author chain 3Y； PDBConstruct 1–274； UniProt 1–274 Author chain 3Z； PDBConstruct 1–274； UniProt 1–274 Author chain 4A； PDBConstruct 1–274； UniProt 1–274 Author chain 4B； PDBConstruct 1–274； UniProt 1–274 Author chain 4C； PDBConstruct 1–274； UniProt 1–274

Cilia- and flagella-associated protein 144

OrganismNot specified

UniProt A8QW39

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF144_BOVIN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 4D； PDBConstruct 1–135； UniProt 1–135

Meiosis-specific nuclear structural protein 1

OrganismNot specified

UniProt Q2KIQ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MNS1_BOVIN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain 4F； PDBConstruct 1–495； UniProt 1–495 Author chain 4G； PDBConstruct 1–495； UniProt 1–495

Nucleoside diphosphate kinase 7

OrganismNot specified

UniProt Q5E9Y9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDK7_BOVIN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain 4I； PDBConstruct 1–377； UniProt 1–377 Author chain 4J； PDBConstruct 1–377； UniProt 1–377

Outer dynein arm-docking complex subunit 3

OrganismNot specified

UniProt A7MBH5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ODAD3_BOVIN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain 4K； PDBConstruct 1–621； UniProt 1–621 Author chain 4L； PDBConstruct 1–621； UniProt 1–621 Author chain 4M； PDBConstruct 1–621； UniProt 1–621

PACRG protein

OrganismNot specified

UniProt A5PK71

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A5PK71_BOVIN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 4O； PDBConstruct 1–257； UniProt 1–257 Author chain 4P； PDBConstruct 1–257； UniProt 1–257 Author chain 4Q； PDBConstruct 1–257； UniProt 1–257 Author chain 4R； PDBConstruct 1–257； UniProt 1–257 Author chain 4S； PDBConstruct 1–257； UniProt 1–257 Author chain 4T； PDBConstruct 1–257； UniProt 1–257

Pierce1

OrganismNot specified

UniProt Q32P67

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CI116_BOVIN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 4V； PDBConstruct 1–136； UniProt 1–136 Author chain 4W； PDBConstruct 1–136； UniProt 1–136

Pierce2

OrganismNot specified

UniProt A0A3Q1LFK7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1LFK7_BOVIN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 4Y； PDBConstruct 1–120； UniProt 1–120

RIB43A-like with coiled-coils protein 2

OrganismNot specified

UniProt Q32LJ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RIBC2_BOVIN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain 5A； PDBConstruct 1–377； UniProt 1–377 Author chain 5B； PDBConstruct 1–377； UniProt 1–377

Sperm acrosome associated 9

OrganismNot specified

UniProt A0A3Q1MYU9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1MYU9_BOVIN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain 5D； PDBConstruct 1–169； UniProt 1–169 Author chain 5E； PDBConstruct 1–169； UniProt 1–169 Author chain 5F； PDBConstruct 1–169； UniProt 1–169 Author chain 5G； PDBConstruct 1–169； UniProt 1–169 Author chain 5H； PDBConstruct 1–169； UniProt 1–169 Author chain 5I； PDBConstruct 1–169； UniProt 1–169 Author chain 5J； PDBConstruct 1–169； UniProt 1–169

Tektin-1

OrganismNot specified

UniProt Q32KZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT1_BOVIN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain 5L； PDBConstruct 1–418； UniProt 1–418 Author chain 5M； PDBConstruct 1–418； UniProt 1–418 Author chain 5N； PDBConstruct 1–418； UniProt 1–418 Author chain 5O； PDBConstruct 1–418； UniProt 1–418

Tektin-2

OrganismNot specified

UniProt Q2T9Q6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT2_BOVIN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain 5Q； PDBConstruct 1–430； UniProt 1–430 Author chain 5R； PDBConstruct 1–430； UniProt 1–430 Author chain 5S； PDBConstruct 1–430； UniProt 1–430 Author chain 5T； PDBConstruct 1–430； UniProt 1–430 Author chain 5V； PDBConstruct 1–430； UniProt 1–430 Author chain 5W； PDBConstruct 1–430； UniProt 1–430 Author chain 5X； PDBConstruct 1–430； UniProt 1–430 Author chain 5Y； PDBConstruct 1–430； UniProt 1–430

Tektin-3

OrganismNot specified

UniProt A6H782

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT3_BOVIN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain 6A； PDBConstruct 1–490； UniProt 1–490 Author chain 6B； PDBConstruct 1–490； UniProt 1–490 Author chain 6C； PDBConstruct 1–490； UniProt 1–490 Author chain 6D； PDBConstruct 1–490； UniProt 1–490 Author chain 6E； PDBConstruct 1–490； UniProt 1–490 Author chain 6F； PDBConstruct 1–490； UniProt 1–490 Author chain 6G； PDBConstruct 1–490； UniProt 1–490 Author chain 6H； PDBConstruct 1–490； UniProt 1–490 Author chain 6I； PDBConstruct 1–490； UniProt 1–490 Author chain 6J； PDBConstruct 1–490； UniProt 1–490 Author chain 6K； PDBConstruct 1–490； UniProt 1–490 Author chain 6L； PDBConstruct 1–490； UniProt 1–490 Author chain 6M； PDBConstruct 1–490； UniProt 1–490 Author chain 6N； PDBConstruct 1–490； UniProt 1–490

Tektin-4

OrganismNot specified

UniProt Q2TA38

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT4_BOVIN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain 6P； PDBConstruct 1–447； UniProt 1–447 Author chain 6Q； PDBConstruct 1–447； UniProt 1–447 Author chain 6R； PDBConstruct 1–447； UniProt 1–447 Author chain 6S； PDBConstruct 1–447； UniProt 1–447 Author chain 6T； PDBConstruct 1–447； UniProt 1–447 Author chain 6U； PDBConstruct 1–447； UniProt 1–447 Author chain 6V； PDBConstruct 1–447； UniProt 1–447 Author chain 6W； PDBConstruct 1–447； UniProt 1–447

TTC25 protein

OrganismNot specified

UniProt A5PK42

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A5PK42_BOVIN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain 6Y； PDBConstruct 1–683； UniProt 1–683 Author chain 6Z； PDBConstruct 1–683； UniProt 1–683

Ciliary microtubule associated protein 1C

OrganismNot specified

UniProt A0A452DIY7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A452DIY7_BOVIN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain 7H； PDBConstruct 1–274； UniProt 1–274 Author chain 7I； PDBConstruct 1–274； UniProt 1–274

Cilia and flagella associated protein 90

OrganismNot specified

UniProt A0A3Q1LU45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1LU45_BOVIN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain 7K； PDBConstruct 1–147； UniProt 1–147 Author chain 7L； PDBConstruct 1–147； UniProt 1–147

Sperm associated antigen 8

OrganismNot specified

UniProt E1BNS6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Tubulin beta-4B chain × 130 （Q3MHM5） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1BNS6_BOVIN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain 7N； PDBConstruct 1–484； UniProt 1–484

Tubulin beta-4B chain

OrganismNot specified

UniProt Q3MHM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin alpha-1D chain × 134 （Q2HJ86） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB4B_BOVIN
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain AB； PDBConstruct 1–445； UniProt 1–445 Author chain AD； PDBConstruct 1–445； UniProt 1–445 Author chain AF； PDBConstruct 1–445； UniProt 1–445 Author chain AH； PDBConstruct 1–445； UniProt 1–445 Author chain AJ； PDBConstruct 1–445； UniProt 1–445 Author chain AL； PDBConstruct 1–445； UniProt 1–445 Author chain BB； PDBConstruct 1–445； UniProt 1–445 Author chain BD； PDBConstruct 1–445； UniProt 1–445 Author chain BF； PDBConstruct 1–445； UniProt 1–445 Author chain BH； PDBConstruct 1–445； UniProt 1–445 Author chain BJ； PDBConstruct 1–445； UniProt 1–445 Author chain BL； PDBConstruct 1–445； UniProt 1–445 Author chain CB； PDBConstruct 1–445； UniProt 1–445 Author chain CD； PDBConstruct 1–445； UniProt 1–445 Author chain CF； PDBConstruct 1–445； UniProt 1–445 Author chain CH； PDBConstruct 1–445； UniProt 1–445 Author chain CJ； PDBConstruct 1–445； UniProt 1–445 Author chain CL； PDBConstruct 1–445； UniProt 1–445 Author chain DB； PDBConstruct 1–445； UniProt 1–445 Author chain DD； PDBConstruct 1–445； UniProt 1–445 Author chain DF； PDBConstruct 1–445； UniProt 1–445 Author chain DH； PDBConstruct 1–445； UniProt 1–445 Author chain DJ； PDBConstruct 1–445； UniProt 1–445 Author chain DL； PDBConstruct 1–445； UniProt 1–445 Author chain ED； PDBConstruct 1–445； UniProt 1–445 Author chain EF； PDBConstruct 1–445； UniProt 1–445 Author chain EH； PDBConstruct 1–445； UniProt 1–445 Author chain EJ； PDBConstruct 1–445； UniProt 1–445 Author chain EL； PDBConstruct 1–445； UniProt 1–445 Author chain FD； PDBConstruct 1–445； UniProt 1–445 Author chain FF； PDBConstruct 1–445； UniProt 1–445 Author chain FH； PDBConstruct 1–445； UniProt 1–445 Author chain FJ； PDBConstruct 1–445； UniProt 1–445 Author chain FL； PDBConstruct 1–445； UniProt 1–445 Author chain GD； PDBConstruct 1–445； UniProt 1–445 Author chain GF； PDBConstruct 1–445； UniProt 1–445 Author chain GH； PDBConstruct 1–445； UniProt 1–445 Author chain GJ； PDBConstruct 1–445； UniProt 1–445 Author chain GL； PDBConstruct 1–445； UniProt 1–445 Author chain HB； PDBConstruct 1–445； UniProt 1–445 Author chain HD； PDBConstruct 1–445； UniProt 1–445 Author chain HF； PDBConstruct 1–445； UniProt 1–445 Author chain HH； PDBConstruct 1–445； UniProt 1–445 Author chain HJ； PDBConstruct 1–445； UniProt 1–445 Author chain HL； PDBConstruct 1–445； UniProt 1–445 Author chain ID； PDBConstruct 1–445； UniProt 1–445 Author chain IF； PDBConstruct 1–445； UniProt 1–445 Author chain IH； PDBConstruct 1–445； UniProt 1–445 Author chain IJ； PDBConstruct 1–445； UniProt 1–445 Author chain IL； PDBConstruct 1–445； UniProt 1–445 Author chain IN； PDBConstruct 1–445； UniProt 1–445 Author chain JD； PDBConstruct 1–445； UniProt 1–445 Author chain JF； PDBConstruct 1–445； UniProt 1–445 Author chain JH； PDBConstruct 1–445； UniProt 1–445 Author chain JJ； PDBConstruct 1–445； UniProt 1–445 Author chain JL； PDBConstruct 1–445； UniProt 1–445 Author chain KD； PDBConstruct 1–445； UniProt 1–445 Author chain KF； PDBConstruct 1–445； UniProt 1–445 Author chain KH； PDBConstruct 1–445； UniProt 1–445 Author chain KJ； PDBConstruct 1–445； UniProt 1–445 Author chain KL； PDBConstruct 1–445； UniProt 1–445 Author chain KN； PDBConstruct 1–445； UniProt 1–445 Author chain LD； PDBConstruct 1–445； UniProt 1–445 Author chain LF； PDBConstruct 1–445； UniProt 1–445 Author chain LH； PDBConstruct 1–445； UniProt 1–445 Author chain LJ； PDBConstruct 1–445； UniProt 1–445 Author chain LL； PDBConstruct 1–445； UniProt 1–445 Author chain LN； PDBConstruct 1–445； UniProt 1–445 Author chain MD； PDBConstruct 1–445； UniProt 1–445 Author chain MF； PDBConstruct 1–445； UniProt 1–445 Author chain MH； PDBConstruct 1–445； UniProt 1–445 Author chain MJ； PDBConstruct 1–445； UniProt 1–445 Author chain ML； PDBConstruct 1–445； UniProt 1–445 Author chain MN； PDBConstruct 1–445； UniProt 1–445 Author chain NB； PDBConstruct 1–445； UniProt 1–445 Author chain ND； PDBConstruct 1–445； UniProt 1–445 Author chain NF； PDBConstruct 1–445； UniProt 1–445 Author chain NH； PDBConstruct 1–445； UniProt 1–445 Author chain NJ； PDBConstruct 1–445； UniProt 1–445 Author chain NL； PDBConstruct 1–445； UniProt 1–445 Author chain OB； PDBConstruct 1–445； UniProt 1–445 Author chain OD； PDBConstruct 1–445； UniProt 1–445 Author chain OF； PDBConstruct 1–445； UniProt 1–445 Author chain OH； PDBConstruct 1–445； UniProt 1–445 Author chain OJ； PDBConstruct 1–445； UniProt 1–445 Author chain OL； PDBConstruct 1–445； UniProt 1–445 Author chain PB； PDBConstruct 1–445； UniProt 1–445 Author chain PD； PDBConstruct 1–445； UniProt 1–445 Author chain PF； PDBConstruct 1–445； UniProt 1–445 Author chain PH； PDBConstruct 1–445； UniProt 1–445 Author chain PJ； PDBConstruct 1–445； UniProt 1–445 Author chain PL； PDBConstruct 1–445； UniProt 1–445 Author chain QB； PDBConstruct 1–445； UniProt 1–445 Author chain QD； PDBConstruct 1–445； UniProt 1–445 Author chain QF； PDBConstruct 1–445； UniProt 1–445 Author chain QH； PDBConstruct 1–445； UniProt 1–445 Author chain QJ； PDBConstruct 1–445； UniProt 1–445 Author chain QL； PDBConstruct 1–445； UniProt 1–445 Author chain RB； PDBConstruct 1–445； UniProt 1–445 Author chain RD； PDBConstruct 1–445； UniProt 1–445 Author chain RF； PDBConstruct 1–445； UniProt 1–445 Author chain RH； PDBConstruct 1–445； UniProt 1–445 Author chain RJ； PDBConstruct 1–445； UniProt 1–445 Author chain RL； PDBConstruct 1–445； UniProt 1–445 Author chain SD； PDBConstruct 1–445； UniProt 1–445 Author chain SF； PDBConstruct 1–445； UniProt 1–445 Author chain SH； PDBConstruct 1–445； UniProt 1–445 Author chain SJ； PDBConstruct 1–445； UniProt 1–445 Author chain SL； PDBConstruct 1–445； UniProt 1–445 Author chain TD； PDBConstruct 1–445； UniProt 1–445 Author chain TF； PDBConstruct 1–445； UniProt 1–445 Author chain TH； PDBConstruct 1–445； UniProt 1–445 Author chain TJ； PDBConstruct 1–445； UniProt 1–445 Author chain TL； PDBConstruct 1–445； UniProt 1–445 Author chain UD； PDBConstruct 1–445； UniProt 1–445 Author chain UF； PDBConstruct 1–445； UniProt 1–445 Author chain UH； PDBConstruct 1–445； UniProt 1–445 Author chain UJ； PDBConstruct 1–445； UniProt 1–445 Author chain UL； PDBConstruct 1–445； UniProt 1–445 Author chain VD； PDBConstruct 1–445； UniProt 1–445 Author chain VF； PDBConstruct 1–445； UniProt 1–445 Author chain VH； PDBConstruct 1–445； UniProt 1–445 Author chain VJ； PDBConstruct 1–445； UniProt 1–445 Author chain VL； PDBConstruct 1–445； UniProt 1–445 Author chain WD； PDBConstruct 1–445； UniProt 1–445 Author chain WF； PDBConstruct 1–445； UniProt 1–445 Author chain WH； PDBConstruct 1–445； UniProt 1–445 Author chain WJ； PDBConstruct 1–445； UniProt 1–445 Author chain WL； PDBConstruct 1–445； UniProt 1–445 Author chain WN； PDBConstruct 1–445； UniProt 1–445

Tubulin alpha-1D chain

OrganismNot specified

UniProt Q2HJ86

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 395	Armadillo repeat containing 4 × 1 （E1B8W3） Coiled-coil domain containing 114 × 3 （F1N2N9） Coiled-coil domain containing 173 × 2 （E1BJL9） Uncharacterized protein C1orf158 homolog × 2 （Q2TA11） Protein Flattop × 3 （Q3SZT6） CFAP141 × 1 （Q32L75） Cilia and flagella associated protein 161 × 2 （F6RJC2） Cilia- and flagella-associated protein 20 × 6 （Q6B857） EF-hand domain family member B × 2 （F1MMV1） CFAP276 × 3 （E1B9I5） Cilia and flagella associated protein 45 × 4 （Q32LN4） Cilia and flagella associated protein 52 × 3 （E1BKF9） Methyl-CpG binding domain protein 1 × 2 （F1N7G5） Cilia and flagella associated protein 77 × 4 （A0A3Q1LJD6） CFAP95 × 1 （Q32L77） Cilia-and flagella-associated protein 96 × 2 （F1N3A8） EF-hand calcium-binding domain-containing protein 1 × 1 （Q32L26） EF-hand calcium binding domain 6 × 1 （A0AAA9SGY2） EF-hand domain containing 1 × 3 （E1BKH1） EFHC2 × 4 （A0A3Q1N1R0） Enkurin, TRPC channel interacting protein × 4 （E1B836） Protein FAM166B × 6 （Q2TBR5） Cilia- and flagella-associated protein 144 × 1 （A8QW39） Meiosis-specific nuclear structural protein 1 × 2 （Q2KIQ2） Nucleoside diphosphate kinase 7 × 2 （Q5E9Y9） Outer dynein arm-docking complex subunit 3 × 3 （A7MBH5） PACRG protein × 6 （A5PK71） Pierce1 × 2 （Q32P67） Pierce2 × 1 （A0A3Q1LFK7） RIB43A-like with coiled-coils protein 2 × 2 （Q32LJ7） Sperm acrosome associated 9 × 7 （A0A3Q1MYU9） Tektin-1 × 4 （Q32KZ9） Tektin-2 × 8 （Q2T9Q6） Tektin-3 × 14 （A6H782） Tektin-4 × 8 （Q2TA38） TTC25 protein × 2 （A5PK42） Ciliary microtubule associated protein 1A × 4 Ciliary microtubule associated protein 1C × 2 （A0A452DIY7） Cilia and flagella associated protein 90 × 2 （A0A3Q1LU45） Sperm associated antigen 8 × 1 （E1BNS6） Tubulin beta-4B chain × 130 （Q3MHM5） GUANOSINE-5'-DIPHOSPHATE × 130 MAGNESIUM ION × 106 GUANOSINE-5'-TRIPHOSPHATE × 134	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1D_BOVIN
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain AC； PDBConstruct 1–452； UniProt 1–452 Author chain AE； PDBConstruct 1–452； UniProt 1–452 Author chain AG； PDBConstruct 1–452； UniProt 1–452 Author chain AI； PDBConstruct 1–452； UniProt 1–452 Author chain AK； PDBConstruct 1–452； UniProt 1–452 Author chain BC； PDBConstruct 1–452； UniProt 1–452 Author chain BE； PDBConstruct 1–452； UniProt 1–452 Author chain BG； PDBConstruct 1–452； UniProt 1–452 Author chain BI； PDBConstruct 1–452； UniProt 1–452 Author chain BK； PDBConstruct 1–452； UniProt 1–452 Author chain CC； PDBConstruct 1–452； UniProt 1–452 Author chain CE； PDBConstruct 1–452； UniProt 1–452 Author chain CG； PDBConstruct 1–452； UniProt 1–452 Author chain CI； PDBConstruct 1–452； UniProt 1–452 Author chain CK； PDBConstruct 1–452； UniProt 1–452 Author chain CM； PDBConstruct 1–452； UniProt 1–452 Author chain DC； PDBConstruct 1–452； UniProt 1–452 Author chain DE； PDBConstruct 1–452； UniProt 1–452 Author chain DG； PDBConstruct 1–452； UniProt 1–452 Author chain DI； PDBConstruct 1–452； UniProt 1–452 Author chain DK； PDBConstruct 1–452； UniProt 1–452 Author chain DM； PDBConstruct 1–452； UniProt 1–452 Author chain EC； PDBConstruct 1–452； UniProt 1–452 Author chain EE； PDBConstruct 1–452； UniProt 1–452 Author chain EG； PDBConstruct 1–452； UniProt 1–452 Author chain EI； PDBConstruct 1–452； UniProt 1–452 Author chain EK； PDBConstruct 1–452； UniProt 1–452 Author chain EM； PDBConstruct 1–452； UniProt 1–452 Author chain FC； PDBConstruct 1–452； UniProt 1–452 Author chain FE； PDBConstruct 1–452； UniProt 1–452 Author chain FG； PDBConstruct 1–452； UniProt 1–452 Author chain FI； PDBConstruct 1–452； UniProt 1–452 Author chain FK； PDBConstruct 1–452； UniProt 1–452 Author chain FM； PDBConstruct 1–452； UniProt 1–452 Author chain GC； PDBConstruct 1–452； UniProt 1–452 Author chain GE； PDBConstruct 1–452； UniProt 1–452 Author chain GG； PDBConstruct 1–452； UniProt 1–452 Author chain GI； PDBConstruct 1–452； UniProt 1–452 Author chain GK； PDBConstruct 1–452； UniProt 1–452 Author chain GM； PDBConstruct 1–452； UniProt 1–452 Author chain HC； PDBConstruct 1–452； UniProt 1–452 Author chain HE； PDBConstruct 1–452； UniProt 1–452 Author chain HG； PDBConstruct 1–452； UniProt 1–452 Author chain HI； PDBConstruct 1–452； UniProt 1–452 Author chain HK； PDBConstruct 1–452； UniProt 1–452 Author chain HM； PDBConstruct 1–452； UniProt 1–452 Author chain IC； PDBConstruct 1–452； UniProt 1–452 Author chain IE； PDBConstruct 1–452； UniProt 1–452 Author chain IG； PDBConstruct 1–452； UniProt 1–452 Author chain II； PDBConstruct 1–452； UniProt 1–452 Author chain IK； PDBConstruct 1–452； UniProt 1–452 Author chain IM； PDBConstruct 1–452； UniProt 1–452 Author chain JC； PDBConstruct 1–452； UniProt 1–452 Author chain JE； PDBConstruct 1–452； UniProt 1–452 Author chain JG； PDBConstruct 1–452； UniProt 1–452 Author chain JI； PDBConstruct 1–452； UniProt 1–452 Author chain JK； PDBConstruct 1–452； UniProt 1–452 Author chain JM； PDBConstruct 1–452； UniProt 1–452 Author chain KC； PDBConstruct 1–452； UniProt 1–452 Author chain KE； PDBConstruct 1–452； UniProt 1–452 Author chain KG； PDBConstruct 1–452； UniProt 1–452 Author chain KI； PDBConstruct 1–452； UniProt 1–452 Author chain KK； PDBConstruct 1–452； UniProt 1–452 Author chain KM； PDBConstruct 1–452； UniProt 1–452 Author chain LC； PDBConstruct 1–452； UniProt 1–452 Author chain LE； PDBConstruct 1–452； UniProt 1–452 Author chain LG； PDBConstruct 1–452； UniProt 1–452 Author chain LI； PDBConstruct 1–452； UniProt 1–452 Author chain LK； PDBConstruct 1–452； UniProt 1–452 Author chain LM； PDBConstruct 1–452； UniProt 1–452 Author chain MC； PDBConstruct 1–452； UniProt 1–452 Author chain ME； PDBConstruct 1–452； UniProt 1–452 Author chain MG； PDBConstruct 1–452； UniProt 1–452 Author chain MI； PDBConstruct 1–452； UniProt 1–452 Author chain MK； PDBConstruct 1–452； UniProt 1–452 Author chain MM； PDBConstruct 1–452； UniProt 1–452 Author chain NA； PDBConstruct 1–452； UniProt 1–452 Author chain NC； PDBConstruct 1–452； UniProt 1–452 Author chain NE； PDBConstruct 1–452； UniProt 1–452 Author chain NG； PDBConstruct 1–452； UniProt 1–452 Author chain NI； PDBConstruct 1–452； UniProt 1–452 Author chain NK； PDBConstruct 1–452； UniProt 1–452 Author chain OA； PDBConstruct 1–452； UniProt 1–452 Author chain OC； PDBConstruct 1–452； UniProt 1–452 Author chain OE； PDBConstruct 1–452； UniProt 1–452 Author chain OG； PDBConstruct 1–452； UniProt 1–452 Author chain OI； PDBConstruct 1–452； UniProt 1–452 Author chain OK； PDBConstruct 1–452； UniProt 1–452 Author chain PA； PDBConstruct 1–452； UniProt 1–452 Author chain PC； PDBConstruct 1–452； UniProt 1–452 Author chain PE； PDBConstruct 1–452； UniProt 1–452 Author chain PG； PDBConstruct 1–452； UniProt 1–452 Author chain PI； PDBConstruct 1–452； UniProt 1–452 Author chain PK； PDBConstruct 1–452； UniProt 1–452 Author chain QC； PDBConstruct 1–452； UniProt 1–452 Author chain QE； PDBConstruct 1–452； UniProt 1–452 Author chain QG； PDBConstruct 1–452； UniProt 1–452 Author chain QI； PDBConstruct 1–452； UniProt 1–452 Author chain QK； PDBConstruct 1–452； UniProt 1–452 Author chain RC； PDBConstruct 1–452； UniProt 1–452 Author chain RE； PDBConstruct 1–452； UniProt 1–452 Author chain RG； PDBConstruct 1–452； UniProt 1–452 Author chain RI； PDBConstruct 1–452； UniProt 1–452 Author chain RK； PDBConstruct 1–452； UniProt 1–452 Author chain SC； PDBConstruct 1–452； UniProt 1–452 Author chain SE； PDBConstruct 1–452； UniProt 1–452 Author chain SG； PDBConstruct 1–452； UniProt 1–452 Author chain SI； PDBConstruct 1–452； UniProt 1–452 Author chain SK； PDBConstruct 1–452； UniProt 1–452 Author chain SM； PDBConstruct 1–452； UniProt 1–452 Author chain TC； PDBConstruct 1–452； UniProt 1–452 Author chain TE； PDBConstruct 1–452； UniProt 1–452 Author chain TG； PDBConstruct 1–452； UniProt 1–452 Author chain TI； PDBConstruct 1–452； UniProt 1–452 Author chain TK； PDBConstruct 1–452； UniProt 1–452 Author chain TM； PDBConstruct 1–452； UniProt 1–452 Author chain UC； PDBConstruct 1–452； UniProt 1–452 Author chain UE； PDBConstruct 1–452； UniProt 1–452 Author chain UG； PDBConstruct 1–452； UniProt 1–452 Author chain UI； PDBConstruct 1–452； UniProt 1–452 Author chain UK； PDBConstruct 1–452； UniProt 1–452 Author chain UM； PDBConstruct 1–452； UniProt 1–452 Author chain VC； PDBConstruct 1–452； UniProt 1–452 Author chain VE； PDBConstruct 1–452； UniProt 1–452 Author chain VG； PDBConstruct 1–452； UniProt 1–452 Author chain VI； PDBConstruct 1–452； UniProt 1–452 Author chain VK； PDBConstruct 1–452； UniProt 1–452 Author chain VM； PDBConstruct 1–452； UniProt 1–452 Author chain WC； PDBConstruct 1–452； UniProt 1–452 Author chain WE； PDBConstruct 1–452； UniProt 1–452 Author chain WG； PDBConstruct 1–452； UniProt 1–452 Author chain WI； PDBConstruct 1–452； UniProt 1–452 Author chain WK； PDBConstruct 1–452； UniProt 1–452 Author chain WM； PDBConstruct 1–452； UniProt 1–452

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9cpb
Deposition date deposition_date	2024-07-18
Structure title title	Atomic model of bovine Fallopian tube cilia doublet microtubule (48-nm periodicity)
Keywords keywords	axoneme, cilia, microtubule, dynein, Fallopian tube, doublet microtubule (DMT), STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9cpb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9cpb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9cpb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	200.40 Å
Total Rg	200.40 Å
Atom count	1132145
Residues	142584
Excluded volume	19997000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9cpb__assembly_1__model_1`	395-meric （395）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (45)

Entity 1 Entity 1 polymer

Description description	Armadillo repeat containing 4
Molecular weight formula_weight	116017.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1A
Atom count atom_count	1132145

MGVALTRSAQWTAAGHGAKTLEVTPLNEAIVKEIIMFVESFIYKYPQEANYVFVEPLEWKTNLDPSAFGSGYAVSGTTVKSEEADKNGEPLLYLSVPQIKIRSFGQLSRMLYIAKNMKLKEAQACIEANRNPVAKILGLDYNIISEKIGNSFVSNILDKITKDDDSESEIKMKIALQLKQLDLHLLNHSLKHISLEIRLNPGTVKNDIELLKQFSGKGKQTVLESIEYTSDYEFSNGCRAPPWRQIKGEICYVLVKPHDAETLCVTCSKEGVFLNGGKTDDEGQINYERKGEIYKDLVTLLKEKSAIFSENMSKQEIKFSEQPQKDQPNEAPKEEVAITHKASVTSRKSTQEKNRINLGRSQLTKRLEPSLNWRTSVSSKDRNTLRDTQVEKHGGKLEKSRSSVSPGRAQLIRKSVEKIEEIISDSSSESEEDEEQPDHRQEANADLPSEYWQIQKLVKYLKGGNQTATVIALCSMKDFNLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPVMVNILDSPHKSLKCLAAETIANVAKFRRARRVVRRHGGITKLVALLDCGKHSGEPAQSSLYETRDVEVARCGALALWSCSKSYANKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEEVLVNVVGALGECCQEHENRVIIRRCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIQNAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAVITNIAKDQENLAVITDHGVVPLLSKLANTNNDKLRRHLAETISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCVTMHENGAVKLLLDMVGSPDEELQEAAAGCISNIRRLALAIEKARYS

Entity 2 Entity 2 polymer

Description description	Coiled-coil domain containing 114
Molecular weight formula_weight	77676.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1D,1E,1F

MPFGLSAGSTRSEDGSEAFLEGMVDWELSRLQRQCKVMEDERRAYSKEVHQRINKQLEEIQRLEGVRHKLRVQISIAQSQVRRLRDSERLESMGHLLKCQVRVQAEVKELQAQNQALDREIQEWESRNSAHSKNARSPGCVQHDKVKSQRRIKSLENQLDKVICRFDIQLAQNATLREELDLLRIERNRYLNVDRKLQKEIQLLKDSVRNLMVSSTSAYTVREEAKAKLGMLRERAEKEVAQNETEVQILQRQIAHLEQLHHFLKLKNGDRQPDSAIVEKREQRAREVAEGLRKTSQEKLVLRYEDALNKLSQMTGESDPDLLVEKYLELEERNFAEFNFINEQNSELEHLQEEIKEMQEALVSGRRSEEDRRAQQEQQRAELQQRVDDVHSEADDLEARYHNFREQLEKLKTNIQHLFTRAQCDSTLINDLLGIKTHMRDRDISLFLSLIEKRLVQLLTVQAFLETQVVVMFNAALMVLGQSSEDFPKKVAPPQPPDNLEDPPGFEAKDDYPLSKEELLSSVMKAEQHLKELVESIKVESTPSMTSSTQKVSSSSRLVTQRPSQVPGSIMSHRTSGILVSSGGRATSSNVGHVTFGDSSATTGGLMSSRGSIPGRVTFRSPNSSSYLGSTGYVGSSRDHDSFEASKGPGSESSGGLGSSPGPASSPGPASSTGQASSTSKDSQSNY

Entity 3 Entity 3 polymer

Description description	Coiled-coil domain containing 173
Molecular weight formula_weight	65437.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1H,1I

MLVRFGRRSGQAKESAEMKNCEEDPVLYPPLLPTKVDLRQVTIIPHNEWERIRDSLDSLTREAACLRAERKAKKEMHLRSQEVVKHWTNTYAGMKEQKLEAKKKRDEEIEAERQILDIEEAIYKQGERKKAIELAKQYQFYQTERVKNFHSGLLLSRVMKERDAQIEFQKSKIKSDKKWEEQVKLNVEKAFKEEREKAEKQRRERVALAKDHLKQIKEHEEEEERRRKEEEKDAEEIKRQNSLYEIEMKKKQGKKKEEINESRRLFFEHLNDKHIIKAVEQQQQEEEDEKIRKFIKAKKRLTQMGKEKEAETHRLMEERRKRINNFLSKLMKEKFDNEDLIIARDIAEAEAEWEKREREKYEKNKAELKAIAEHRALVMKNKEEEERQRKIEATEQMLAILKADQIFWEHEKEKKQKADKERREVQDAHIQQMAKHKFNALQAKQAESEYCRLTEALVAEKEKEFQDYAREVIESESESTKKYIYPLVKAVQEGPGGGRGPVLVDRGGLRPSYQANDTTGVQLPFYNSPGSKYNNFQKSKGRLGFTW

Entity 4 Entity 4 polymer

Description description	Uncharacterized protein C1orf158 homolog
Molecular weight formula_weight	23271.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1K,1L

MQFLTAVSPQSSSTPSWKIETKYSTRVLTGNWTEERRKFIKATEKTPQTIYRKEYVPFPGHRPDQISRWYSKRTVEGLPYKYLITHHQEPSQRYLISTYDDHYNRHNYHPGLPELRTWNRHKLLWLPEKADFPLLGPPTNYGLYEQLKQKWLPPPEATLRESIYTSSYPRPPAGAMSRREHAIPVPPPRLQPVPHF

Entity 5 Entity 5 polymer

Description description	Protein Flattop
Molecular weight formula_weight	21214.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1N,1O,1P

MATNYSANQYEKPFSPKYLQNWSLAKPTKERISSHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLKVPPARATLTSRTAAGAASLTRWIQKNPDLLKASNGLRPEIFGKPHDPDSQKKLRKSITKTVQQAPSPTIIPSSPASNLSSPDQLQSSHPSAGHTPGPQSPLNSPKCPPGSPCLPHAGRNLAEV

Entity 6 Entity 6 polymer

Description description	CFAP141
Molecular weight formula_weight	12361.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1R

MSMEKMGKVEEHFQRALELKKMVHRWRNSHTHCLWQITLSQRRNPYAILRMQDTMVQELALANKQLLMVRQAALHQLFEKEHQQYQQELNEKGKAFYMERL

Entity 7 Entity 7 polymer

Description description	Cilia and flagella associated protein 161
Molecular weight formula_weight	36519.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1T,1U

MAQNLYGPRVRIGNWNEDVYLEEEIMKDFLAKRDKGQLLIQRNRRLKENLLRPMQLSVSEDGYIHYGDKVMLVSPDHPETEADLFLPGDLSLCMTPDEIKAHLSNELEVPCGLSAAQTKIPVGRNTFTILCAAGEVIGQVLRYGQNFRLGITGGFDDRMLYLSSDHRTLLKSSKRSWLQEVFLTHEDSYLNCWQAAFPHPQLRLEYEGSPVPANTKILITHCHTNRGLVAHRHLFLRTYFGQEAEVAAHTYLDSHRVEKPKNHWMLVTGAPRKDLSTMLDLPKPPAEDTRALEQEREQVSDPGARSTPDARGCVPQCTLPM

Entity 8 Entity 8 polymer

Description description	Cilia- and flagella-associated protein 20
Molecular weight formula_weight	22781.4 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1W,1X,1Y,1Z,2A,2B

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Entity 9 Entity 9 polymer

Description description	EF-hand domain family member B
Molecular weight formula_weight	97960.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2D,2E

MCSFLRVPSPKGLEPSKGLGAPLQPGTAYPSEMSALGPGMTVSGRKSPLSMEVGLAPEGKDDLEERRVFMGTTSPTELGLRVGLRKDFPCSKTYEERMASPEIRSPSSKGLELRLKRQNISRTVMDGSNLGVHRVSASQETKPPLSALPGRVGLEKERFLAGYCPGRVTQPPLGQGCESPQASGGRRCPVTGDPEGFGASVSKLPALGMECRGELGGESACVVMKPRAETEPPVEVDMGLTRLEEPAEMESPEPQMGLVMEPPAWQLAQQPEEQREAENTEPGVEPPDRIRPIYSGKFFDRMPCWPSAGKVLPIGYRAATCLTERFPRLMTPPEAKKFFNFRYPPAGAERVFYGRANDPQIAPSLTHGIRSKISIPAKVLINPQPITTFQQKMKDKKESVYFSNQRAPLGKSHDQTPGLPKGLDILNTTFGTAIVRETSARDMVNPPKPYKEVFEEAQAGHDLYVVSHNDYFVGEAKNRKYDPSSFHRFNLYGIPTPHFNDGRNMAKTLHWLHELQMKRGAKIVSKRVDDFKEKFQHRLGRVLDPIAETMNVPPDYTFGAFLRPEDYGVGDLIHRRLPGEYLRGKDRQRGLVAAVRHHLKKVNYQNFDTLLAAFRHYDKKGDGVIDRAELQEACDQACLHLDEKLLDQLFEYCDVDKDGLINYLEFANFLTWKDKTPLKEYEERVLIKGRKADCANPAEANVEESEPALLLKPEDIVLKEPGSSEKTLRTLLRPSDKVSNHYKTTSSEISAVVGAVPSTCYPTYGVPTIRSDIPAPLIRRVSDRTSYGEEGNAYSLLHPTIFAQKGVFERDFFKTRSKQEISEILCNIGVKLSEDEFENVWNLASKKHHRGEVCVENIRSVLDELQHADGAKCKAAT

Entity 10 Entity 10 polymer

Description description	CFAP276
Molecular weight formula_weight	19387.8 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2F,2G,2H

MPLTRDPFQNPALDKDDSYLGKSRASKKLPYKNPTHLAQQQEPWCRLSSTPTITSMKRDGFFFYSEIPKDDLDFRLAALYNHHTGTFKNKSEILTHQETIQDTRRIKTQFPGEFLPAPQPPLITSRANIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFST

Entity 11 Entity 11 polymer

Description description	Cilia and flagella associated protein 45
Molecular weight formula_weight	65800.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2J,2K,2L,2M

MPLSTAGVLSSASTASNRSRNRPRYRTKALSSEVDESLFGAIKPLTRSDSPIVLLRDKHAIRKTLTALGLDHKPETIQLITRDMVRELIIPTKDPSGQSLIMSPEEFERIKWASHVLTKEELEAREQAFKKEKEAIVDTVTTRKKIMKQKEMVWRNNRKLSDLEEVAKERAQNLLQRANQLRMEQEEELKDMKKIILNAKCHAIRDAQILEKQLIQKELDAEEKRLDQMMEVERQKSVQRQEELDRKRREERIRGRRHIVEQMEKNQEERSLLAEQREQEKEQMLEYMEKLQEEDLRDLEQRHQQKLKMQAEIKRINDENQRQKAELLAQEKLADQMVMEFTKKKMAREAEFEAEQERIRREKEKEIARLRAMQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENAQKKMETEAKLRKSRLEQVAFKEHTLAVQVQRDRDEFERILRAQREQIEKERLEEEKKATGRLQHANELRRQVRENQQKQVQARIATFDEGRRLKEEAQKRRERIEDIKRKKLEELRATGLPEKYCIEAERKANIPVNTSVN

Entity 12 Entity 12 polymer

Description description	Cilia and flagella associated protein 52
Molecular weight formula_weight	68719.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2O,2P,2Q

METQASPKDEVAEAVELELEAVIGFNGHVPTGLKCHPDQEHLVYPLGCTILIQAINTQEQNFLHGHGNNVSCVAISKSGLYIASGQVTFMGFKADIILWDYKKRELMARLSLHKGKIEALAFSPNDMYLVSLGGPDDGSVVVWSIAKREAICGSPAAGLNVGNATTVIFSKCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVMSISMANDDSFFYLGTTTGDILKMNPRTKLLADTGPAKDKFSLGVSAICCLKMGGLLVGSGDGLLVFCKSPSYKPIKKIQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTNFKETLITTCHFESVEDIVFPFGTAELFATCAKKDIRVWHTLTNRELLRITVPNMTCHGIDFMRDGKSIISAWDDGRIRAFAPETGRLMYVINNAHRIGVTAIATTSDCKRVISGGGEGEVRVWHIGHQTQKLEEALKEHKSSVSCIRVKKSNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELDGSLSGAVNGMDITVEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWKYPFPS

Entity 13 Entity 13 polymer

Description description	Methyl-CpG binding domain protein 1
Molecular weight formula_weight	62139.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2S,2T

MYSQRFGIVQREVKGPTPKVVIVRAKPPKGQGAEHHLQRIQHSHQKHHAILASIKSIERDRLKTEWDQHNDCKFVDSLVKARVKDAMQGFIINTEERRNKLRELLASEENEYFTEMQLKEETIEEKKDRMRDKIRLLREKKEKERQDFVAEKLDQQFRERCQELRAELFCIHQKAVCEERKAQIAFNEELKRQKVVEEQMFSKLWEEDRLAKERREAKEERRQKELVENTRLGLNAQVTSIQAQRQAAQRLKEEEALLVENENAQVKLENEQDKLKKQKTKQEIRAALQKALQEKMERMQQEYREEQDLNMKLMQNALQSLQEETDKKKQKKEDMRREQKIYYQYLAQRHEEEKAQEKELDRMLEKEKEKKFAEKDKELRLEKEARKQLLNEVMCTRKLQVQEKLQRKAKEQEERTMEQERINEGLKELNCEERENFIRRCSLAQEYRKQLQMQICSQQQAREAEEEEERREFEAGIAAEKSFQDKIQGILSTHQVVPRNIHPMRRACSTKLPP

Entity 14 Entity 14 polymer

Description description	Cilia and flagella associated protein 77
Molecular weight formula_weight	32999.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2V,2W,2X,2Y

MPEARNSCQDLTRWKKKKPPVRRTVSQICPPPRRPLTVADIRPGMENERLGVVRDSMFQNPLIVKAELGKPRERSCSLPGINFNYGLYIRGLDGGVPEAIGHWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENLHYRQLNDIRISDQDDRRLKKEPPSLPPNMTFGIRARPSTPFFDLLQHRYQQLWVQEQKDTQKAIKLEKKHKVILGKLYETRSSQLRKYKPPMGLDTLWHMPHFQKVGPHLATFPTEADRQRAFKAHREECAVRQGTLRMGNYTHP

Entity 15 Entity 15 polymer

Description description	CFAP95
Molecular weight formula_weight	26661.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3A

MDSSDSSCQEWCSHGQYWLELGPTDLMERKGSLTLRSHHKKYSKPVLVYSWHRDRETYPKDYDIEGPEEVKKLCNSTYRRLGTSEPPVWISETREKMAQVCLNTKLAKIKSKALLNEETMNSGIIERDTGLPATGFGALFTRHSPDWSKMCTLTTYAEEYAPPYEYQPLGDPCQDDDYSIVHRKCRSQFTDLDGSKRVGINTWHDESGIYANSYVKRKLYSLTGGPIAPFLK

Entity 16 Entity 16 polymer

Description description	Cilia-and flagella-associated protein 96
Molecular weight formula_weight	34554.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3C,3D

MPAEGGKTDMERIGLFSEMEYITVGDKYVSQFNRPFNESASKNRQILPGGSKEMSNLQAGYFDPHFVRIFEGESYVNPNQVRRRYMMEEAKKNLSKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPKEKYEPPGKNLYTNPGKKGTGYGYANITIGKQFSHSSDLYDAAKLNNKKENEEHRRLLKGTAFKLNLYPREYFDTNPYMSEKPLPPIKKVEKKETVGNPFKPSSPGKKAGGMKAGTFDPYPSHSADPYVVKLKSPSSKSAKVFHPPGGPKSRPIESIMALNVKRALNMKNYKTASVQSY

Entity 17 Entity 17 polymer

Description description	EF-hand calcium-binding domain-containing protein 1
Molecular weight formula_weight	24667.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3F

MNRKKLQKLTDSLTKNCKHFSKFEVKCLINLFYNLVGEVTERQGVIIGLDRNAFRNILHMTFGMTDDMIMDRVFRGFDKDNDGCISVTEWVYGLSVFLRGTLEEKMKYCFEVFDLNGDSFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYEQAVREETLLLEAFGPCLPDPKSQSEFEAQVFKDPNEFNEV

Entity 18 Entity 18 polymer

Description description	EF-hand calcium binding domain 6
Molecular weight formula_weight	162942.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3H

MTVTKSELRRVITTFLLPLTREQFQDVLAQIPLTSSGAVPYLVFLSRFGGIDLNINVIKRGGENEMNGCRTLKDLEAQVGEKIFKNIKTVIKALMLIDVNTTGLVQPHELRRVLETFCLKMKDEEYKKFAQHYNIDKDAAVDYNVFLKNLGSNNDLNLKYNMGSQEVLWENQRVKSFKREEPPSSAVSDNIWKNYSLDEIETAFCLELSKCYEKVEKALSAGDPCTSGYVSLNYLKIVLDTFVYRLPRRIFIQLMKRFGLKTTTKVNWKQFLTSFYEPQYEASSKAPLTKRNSINFRNQVHKENVITKLFRHEDHDSSLKKALLLIKSKPDGQITGQELQRILNCMVVKISDSEFRELMRILDPGCTGCVNVSRFIELIEESPKLHKIPAYKDTKMPLFLAWDSVEEIIHDSIAKNLSAFCNMLRSYDLGDTGLIGRNNFKKIMRVFCPFLTTEHLVKLCSKFQDIASGRILYKKLLACLGINRPPTVSPVSMPKGQLLNEHLQKEEQPLPDHSERATPAESQGAVTRNMTKDEVIEKLKSCIQQQDPAFRKRFLDFTKEPNGKIHTHDFKKVLEDYGMPMDDDQYALLTTKLGYKKEGMSYLDFAAGFEDPKMNEPEVTPPQTPVLPKGDVDSFFVTAEECLRQFPRRLKEFFRDPYAAFFKMDTDRDGILTMHDLHRLLQHLLFNLKDEEFERLLGLLGLRLSITLNFREFRNLCEKRSFSADDDAPQRLPRPKQKVADSELACEQAHQYLVTKAKTRWSDLSKNFIETDSEGNGILRRRDMKNALYGFDIPLTPREFEKLWMRYDSEGRGHITYQEFLQKLGINYSADIHRPYAEEYFNFMGHFTKPQQVQEELKELQQSTEKAMPARDKLKDHDQDISKALAKLDKSRTGYISLGRLQRLLQECGCSLKEEELIDLLNSWGIAWHNNSINYLDFLRAVENNKLTRPQSQEKEESVPINFAALSPEEVLKNIQGVIAASSLALSTAFSALDKEDTGFVKASDFGQVLKDFCYKLTDNQYHYFLRKLRLHLTPYINWKYFLQNFSSYVEETAVEWAEKMPRGPRPLSPKEMANQELLARLHKAVTSHYHAIAQEFENFDTMKTNTASRDEFRSICTRHVQVLTDEQFDRLWEEMPVNSKGRLRYLDFLSSFNVDKQATPLATSDSAKAQRGSSVPEVSDRGRSAGSSPTRDPKAGSKPRSHPCTPSSVSGTPPLQNCEPIETKLRKKVQGCWRELLRECKERDFNKQGEIPGPEFLALVEKFNLDISRDECQQLLIKYDLKNNGKFAYCSFIQSCVLLLKAKETSLMQRMKIQNANKMKEAGAETCSFYSALLRIQPKIVHCWRPMRRTFKAYDEGGTGLLSVADFRKVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFLQ

Entity 19 Entity 19 polymer

Description description	EF-hand domain containing 1
Molecular weight formula_weight	74125.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3J,3K,3L

MVSNPVHGLPFLPGTSFKDLTKTAFHRSQTLGYRNGYAVVRRPTVGIGGDRLQVNQLSQADLDELASKIPILTYGQARQAPPAAFVPAHVAFDKKVLKFDAYFQEDVPMSIEEHYRIRQVHIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRLSKNDRGDHYHWKDLNRGINITIYGKTFRIVDCDKFTQVFLESQGIELNPPEKMALDPYTELRKQPLRKYVTPTDFDQLKQFLTFDKQVLRFYAIWDDTDSMFGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRMPKVLVENAKNFPRCVLEISDKEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQYYQEKFGISDLPRIDMSKKEPPPMKQELPPYNGFGLIEDSAQNCFALIPKAPQKDVIKMLMNENKVLRYLATLESPFPEDKGRRFVLSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPGSSVENPVYYGPSDFFIGAVIEVFGHRFVILDTDDYVLKYMESNAAQYSPEALLSIQNHIRKQEAPAPELDGQQAEEDPGVRDLEALIDTIQKQLKDRPCRDNIREAFQIYDKEASGYVDRETFFKICGSYQLPVDDSLIKELIRMCSHGEDKIDYYNFVRAFSN

Entity 20 Entity 20 polymer

Description description	EFHC2
Molecular weight formula_weight	85566.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3N,3O,3P,3Q

MGKEKFHKSQHWGFCNNVRMLVGEDKPGIGGELLFGQKIKPKYSVFPKGMGTDSPSWVAFDKQVLSFDAYLEDEVPDKSQENYRIRRYKIYFYLEDDTVEVNEPVLQNSGLPQGIFIRRHRISLPPPNEDQFYTVHHFNVNTDIVFYGRTFKVYDCDAFTKNFLTKIGVKLNPPGQCPEDPYMKTRREKLDCMEPICPYESFDTLKQFLEYDRKVLRFFCVWDDSGSVFGDRRELILHYFLSDDTIEIKEVLPHNSGRDAMSLFLQRRKLPKYGPPGVYQPGQLTDQTVLNVYGGYSETRVYGFLLDKYQLGKLDQEFYKDTDLSIGTTINVWGRKVLLCDCDDFTKTYYRTKYGIENFTSIPCKAPSPPKIERKFPPYTGFGSEEDSLRSCIGLMPTPHQRNFKKFIEFDSYGNISNTLRFFAKLITHKCADVERMFVISYFLSDDTISVFEPIERNSGYTGGMFLKRVRVKKPGQEVFKSEFSEYIKAEELYVGAKVNVNGYLFFLVNADEYTLNYMERNSDKFPLSSIELVIQKLKEEECKSRELKQVFTAADCMHTKMVDFNTFREIMMNLTVGKLTDQEVITIARRYRVPEDPCPHRNVLVAQAHEQLKKNAFENFERLIAMCVYEDREKKKVLPSKDIKRLCKSSRLPLNEDLLGSLLSGFEDSEKQINYESFFCALNWRVNPVPVLEVASYIKERCEDEWLGMPSPIPVKYIYYLNLLKDVFGVDE

Entity 21 Entity 21 polymer

Description description	Enkurin, TRPC channel interacting protein
Molecular weight formula_weight	30215.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3S,3T,3U,3V

MVAMDPTGPSESIYNLIPSDWKEPPQPPRYVSIFKATVKDDMQKFKTAMKTMGPAKLEVPSPKDFLKKHSKEKILPPKKKFEWNERRKPPVPLRTDHPVMGIQSEKNFINTNAADVIMGVAKKPKPIYVDKRTGDKHDLETSGLVPKYINKKDYGVTPEYICKRNEEVKKAQEEYDNYIQENLRKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQKLEEEMKQLEHDIGVLEKHKVIYIANKK

Entity 22 Entity 22 polymer

Description description	Protein FAM166B
Molecular weight formula_weight	30551.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3X,3Y,3Z,4A,4B,4C

MASTFIPGLNPQNPHYIPGYTGHCPLLRFSMGQTYGQMTGQLLRGSPGLAWPPAHRTLLPPIQPPRSPEPRRRSLPVRPGHERLSSSMVPGYTGFVPQAQFIFAKNCSQVWAEALNGFTQRNGGQGSQELPKEAKGEKDVEKDQEPKPEVEKEPELGQEAEQASPYSMDDRDPRKFFMSGFTGYVPRARFLFGSSFPVLSNQALQEFGEMKSPGRSQKDPKHLPALSRTYPQHLGLLPKYGGYVPGYKFQFGRTYGHLTQDALGLSTLQKQLLV

Entity 23 Entity 23 polymer

Description description	Cilia- and flagella-associated protein 144
Molecular weight formula_weight	16178.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4D

MAGHQKEKAIADEVHQNQILRELYLKELRTQKLYTQYHVNPLRKVHTIARKPMSWHDNLEEPADARFLNLIHHAAQGPRKKYPETQTEGQEIGWDSEPLVNPQRDDRRLNHFRVYKDITLYKAKMWSLGEDDRHK

Entity 24 Entity 24 polymer

Description description	Meiosis-specific nuclear structural protein 1
Molecular weight formula_weight	60538.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4F,4G

MASIRRTLSFSERHQKLVDINYCKKLHVEALQRLQNQTRDQMVQNENDDRAERKRFLRLLQDEQFELDMEEAIQKAEENKRLRELQLAQEEKLATELAKLKRESLKDEKLRQQVRENSAELRELEKKLKAAYMNKERAAQIAEKDAIKYGQMKRDAEIARTMMEEHERLIKEESAAEDKRNQAKAQYSHDLEKQLEEQGKKKQEAYEQLLKEKLMIDEIVRKIYEEDQLERQQRLEKMNTTRRYIEEFQKEQALWRKKKREEMEEENRKIIEFAKLQQQREEDRMAKVQEKVKKKRLQLKNMLTQRLEEMLRQREDLEQVRQELYQEEQAEIYKKKLEEEAEEKLRKQKELKQDFMDQMALKELILQAAKEEEETFRKAMLAKFAEDDRIELMNAQKPRMKQLEHKRAVEKLIEERRNQFLADKQRELEEWQWQQRRQGCINAIVEEERLKLLKEHATKLLGYLPKGVFKNEDDIDMLGEEFRKAYQKRSEICEK

Entity 25 Entity 25 polymer

Description description	Nucleoside diphosphate kinase 7
Molecular weight formula_weight	42650.9 kDa
EC 编号 ec_number	2.7.4.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4I,4J

MNHSERFVFIAEWFDPNASLFRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYEDLHLEDLFIGNKVNIFSRQLVLLDYGDQYTARQLGSKKEKTLALIKPDAVSKAGEIIEIINKAGFTLTKLKMMTLSRKEATDFHIDHQSRPFLNELIQFITSGPIIAMEILRDDAVCEWKRLLGPANSGLARTDAPESIRALFGTDGIKNAAHGPDSFACAAREMELFFPSSGVCGPANTAKFTNCTTCCIVKPHAVSEGLLGKILMTIRDAGFEISAMQMFNMDRINVEEFYEVYKGVVSEYNEMVTEMYSGPCVAMEIQQTNPTMTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILDN

Entity 26 Entity 26 polymer

Description description	Outer dynein arm-docking complex subunit 3
Molecular weight formula_weight	72164.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4K,4L,4M

MTSPLCWAAASNAMPSQDQISTPSKVKATQVQLKPYRSRGKGLVPVWHSLHSKAGPLHASEGKSAVNMQVAELQRKIQLLEGDRKAFYESTQWNIKKNQETINQLREETRVLQLQLTALLQGDEKVVQAVIREWKSEKPYLKNRTGQQALEHLDYRLNEKVKQLNALRHQLGLRQKWLEELQLQHSLRELEIAEAQDSNTEVAKTMRNLENRLEKARMKAEEAEHITSVYLQLKAYLQEESLHLGNRLDFMEAEVVRTKHELEELHLVNQEALNARDIAKNQLQYLEETVFRERKKRERYLTECKKRAEEKKLQNERMERKTQREHVLLQSDDTLQDSMYSKEEELKRRWSMYQMEVLFGKVKDATGVAETHAVVRRFLAQGDTFTQLEMLKSENEQTLLRLKQEKQRLQQELEDLKYSGEALLVSEQKRQAELQGRLKMEEQRRADAQNQLDRTMRALQITKEGLEHLAGKLNHIVVAGPTYEEGSPGASLDTKGSATPQPQETGRSVGKMDPKVDDYLPNLLGLVEEKLLKLHSQLENHNVPEMLRHIVDLEFYATLEGKLPSYNTRIALPVAGHKDKFFDEEESEEDDSDVVTRAALKMRSQKLIESRSKRRGRSRRS

Entity 27 Entity 27 polymer

Description description	PACRG protein
Molecular weight formula_weight	29323.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4O,4P,4Q,4R,4S,4T

MVAEKETLSLNKCPAKLPTRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPSAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGEALVPYYRQILPILNIFKNKNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVPTYESCLLN

Entity 28 Entity 28 polymer

Description description	Pierce1
Molecular weight formula_weight	15673.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4V,4W

MSEEDPKACAEPEEPKAGPPPEKTSDWYRVSEDLPARFNNPAWFRGYRTKEPPSVYRTSNQAYGSRAPTVHEMPKVFYPNSYKFSRQVAVGGMFQNNTLNVYMEKSIVTGPDNYITSYDRLNFHPSYRVCRPSICD

Entity 29 Entity 29 polymer

Description description	Pierce2
Molecular weight formula_weight	13784.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4Y

MTECDWEKKSTSASNSDTEMKPELPPCVNPGNPVFSCMLDPKTLHTTTSLSKPKMIMYKTNSSNYGEFLPMPQFFPCYYTPREQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNFQHTL

Entity 30 Entity 30 polymer

Description description	RIB43A-like with coiled-coils protein 2
Molecular weight formula_weight	44773.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5A,5B

MEVAQPKDLKEDFVLAKRRHAELVRQKRIFNARNRIIGGDTTAWDAQVCDQNIKAATEKARDEAFAAEMRQNDKIACLSENRERRDRKNLCKAINDFQQSFQRPETRREFDLSDPLALKKDRPARQSDYDARNTISGMQKFMGEDLNFHLRKKFQEEQNREWSLQQQKEQMIGRENQKCAEDLYLKTRLQFDETAKHLQNLETATRKAVCATVKEFNKNQALESAEKKIQERKQEQEDNLAEISNMLRGDLLSENPQQAASSFGPHRVVPDRWKGMSQEQLEEIRLVQRQQVQEKLRLQEEERQRDMDWDRRRIQKARATLLFEQQQQRLQRGLRRALDCSNLSLAREQLLQKKHMKELCTNHATEDYFTQFNTGSR

Entity 31 Entity 31 polymer

Description description	Sperm acrosome associated 9
Molecular weight formula_weight	19345.2 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5D,5E,5F,5G,5H,5I,5J

MMNEVKESLRSVEQKYKIFQQQQFTFIGALEHCRENAHDKIRPISSIGQVQSYMEHHCSNSTDRRILLMFLDICSELSKLCQHFEALHAGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPIILDLMKEWVAHSEKLPRKALQQGAT

Entity 32 Entity 32 polymer

Description description	Tektin-1
Molecular weight formula_weight	48798.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5L,5M,5N,5O

MAKLLQQPPKFLRAEWQIANKNQYHRAEAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVYATEDLLLYQTRLQKALESFKEPLHITEKCLEYREKRVGIDLVHDEVEQELIKEHEIIRGVMTLLTRTLEETCEQIRLNRSAKYNLEKDLRDKFTAITIDDICFSLNNNSPNIKYSENVVRVEPNSVSLEDWLDFSNTNVEKADKQRNNSLTLKALVDRILFQTASDLRRQCDVVDTAFKNGLKETKDARDKLALHLDKVMEEIASQEKNIVVLEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLIKEVDEITHNVARLKETLAQAHVELKGLNRRQLALQEEIQIKENTIYIDEVLCVPMRKSIPPRDGDDHGEWAGGSHPEAVC

Entity 33 Entity 33 polymer

Description description	Tektin-2
Molecular weight formula_weight	49962.7 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5Q,5R,5S,5T,5V,5W,5X,5Y

MATLSVKPSPRFRLPDWQTNSYLLSTNAERQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLAERIDTVSRWKEMLDKCLTDLDAEIDALAQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEEELHKEVEVIEATKKALQQKISQAFEKLFLLQEARQRLNSDHRGKMETLDIDRGCLSLNLTSPNISLKINPTRVPNGSTSLQQWDDLSRFNKDHGEAEMKKAIELREAIALTIAETNNELEAQRVATEFAFRKRLREMEKLYSELKWQEKNTLEEIAELHEDIRHLEEDLRRKLQNLKLCHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALYKHLARLQADIACKANSMLLDTKCMDTRRKLTVPAEKFVPEVDTFTRTTNRTLSPLKTCQLELA

Entity 34 Entity 34 polymer

Description description	Tektin-3
Molecular weight formula_weight	56760.9 kDa
Source method src_method	nat
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6A,6B,6C,6D,6E,6F,6G,6H,6I,6J,6K,6L,6M,6N

MELLGSTLTATYAHPRPTPTNFLPAISTMASTYRDRFPHYNLTHSLSLPWRPSTYYKAASNWPTLDPYCTRSQRVSESTMLPFVSNRTTLFTRYTPDDWYRSNLTNFQESNTSRHNSERLRVDTSRLIQDKYQQTRKTQADSTQNLGERVNDIGFWKSEIIHELDAMIGETNELTDIKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEKELLTEVDTILCCQERMKLYLDKAIAQLAANRAAQHELEKDLSDKQSAYRIDDKCHHLRNTSDGVSYFHGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIQNVLVVTANEMWNQFNKVNLAFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIVEKSAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVYEVDDTIQTLQQRLRDAEDTLQSLAHTKATLEHDLAVKANSLYIDQDKCMSMRRSFPSTLRLVGFC

Entity 35 Entity 35 polymer

Description description	Tektin-4
Molecular weight formula_weight	52025.5 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6P,6Q,6R,6S,6T,6U,6V,6W

MAQTDILLTKEPAPQTVPACQLPRKLYDVARNTGAHTSSGLATSGFRTAKYLLDEWFQNCYARYHQAFADRDQSERQRHESQQLAAETEALAQRTQQDSTRKVGERLQDMHGWKSELQRQVEELVSETELLLAQKQRLERALDATAGPFSIVTDNLQCRERRQHPDLVRDCVEIELLKEAELIRNIQELLKRTIKQAVSQIRLNWEHKETCEMDWSDKVEAYNIDEACCRYNNQSTDVQFYPHSAKFEESASTPETWAKFTQEHLYRAERERLASVNLRNLIDCILQDTSEDLRLQCDAVNLAFGRRCEELEDARHKLEHHLRKTLREISDQEHNIAALKQAIKDKEAPLKVAQTRLYQRSHRPNVELCRDAAQFRLASEVEELNLSLAALKEKLLEAEQSLRNLEDTRMSLEKDIAIKTNSLFIDRHKCMAHRAHYPTVLQLAGYQ

Entity 36 Entity 36 polymer

Description description	TTC25 protein
Molecular weight formula_weight	78492.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6Y,6Z

MADPENEVLRSTFPSYMAEGERLYLCGEFAKAAHSFSNALHLQSGDKNCLVARSKCFLKMGELEKSLEDAEASLQGDPTFCKGILQKAETLYTMGDFEFALVFYHRGYKLRPDREFKVGIQKAQEAINNSVGSPSSIKLENKGDLSFLSKQAESMRAQQKPHPVRQLIHHPKRESKRKGSLKSEKIVRQLLGELYVDKEYLEKLLLDEDLIKGTIKHGLTVEDLIMTGINYLETRSDFWRQQKPIYARERDRKLMQEKWLRDRKRRPSQTARYILKSLEDIDMLLTSGSAEGSLQKAEKVLKKVLEWNKEEVPNKDELVGNLYSCIGNAQIELGQMVAALQSHRKDLEIAKEYDLPDAKSRALDNIGRVFARVGKFQQAIDTWEEKIPLAKTTLEKTWLFHEIGRCYLELDQAWEAQSYGEKSQQCAEEEGDMEWQLNASVLVAQAQVKLRDFESAVNNFEKALERAKLVHNNEAQQAIINALDDANKGIIEELKKTNYREILKEKKEKENATMLDGQTRTAKEKETRKTKDEPEKVMKQWVQEQTEKQLEGVLSKETLGVTARQPEQRQREDPEKASWRKELGAKERGPGDTAKGQFGEAGRTEQNREETREIYRRPSELDQNLSDESSPRESEGLEKRLSKTDGGELEALGKTESGEIKEMEITENSEKIEKDEKEDEPIE

Entity 37 Entity 37 polymer

Description description	Ciliary microtubule associated protein 1A
Molecular weight formula_weight	27684.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7C,7D,7E,7F

MAEEVWVGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFVKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYSVNPKILRTGKDLGPAYSILGRYHTKTTLTPGPGDYFPEKSTKHVFDSAPSHSISARTKTFRVDSTPGPAAYMLPMVMGPHTIGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTDVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTMTRPCAPVVSFGIKHSDYMTPLVVDVD

Entity 38 Entity 38 polymer

Description description	Ciliary microtubule associated protein 1C
Molecular weight formula_weight	30860.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7H,7I

MKLPKGVKNPVFYGQQPEKKVPMSSGHEIKQTPVVLAMLKGPGPAKYLRPSCTGYIDHDVSMFQEPAYTLHAWHPEKRIMDIRSPGPCYFLDPKITRFGMVSCPQVPMAEHISNLRLSPTPAPCHYHLEKTHLPGERRAPGYSFGFRCPYRVMDPNPGPNRYQMPLLLGPNLPANKAAPCYSLAPLDKNWFYKNMSRGPGPAAHTRPEPSVYQNRSPVYSMAKRFGYPVDHTPRPGPGSHNVQQVRAHKPRPPAFTMGIKHSPHLCPLIVDIRD

Entity 39 Entity 39 polymer

Description description	Cilia and flagella associated protein 90
Molecular weight formula_weight	16820.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7K,7L

MEDDEEEITAAALRGKPRPLPISALSAFSYIPPRRQDPKEHSYYYRQGWTGIISLYDCVFKRDPGYNQKLHRDDREHAKSLGLRINEEECERPVGVLSSSVYGRRIDQPVEPLNRDHGRAGHVKADFYRKNDITSIKAPGFGHISPA

Entity 40 Entity 40 polymer

Description description	Sperm associated antigen 8
Molecular weight formula_weight	51604.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7N

METSESTDRSQSRCLDLQPSSDGLGSSSDPFSSWDGRHRSALVAATAAASAAATAASTARAAALWTKSPAPYSHGNLLTEPSSDSLTERYTGPRFTHKISHGRLGFQPAYFSHIAWNPYTTNDLSSSRGPIPGSSSGPVPGSSSSPGPDSSSDPGPSSSSGPGGSPGGSGRGPGHGPGPGGGSGQGPGGGSGQGTDLGPAIDSRHSPGHGHGPRFNFSAPVGFRNPRGDLIPNYTGCKHHCHWEPQKQSWKFLKVSEPGARGLWKPPEVEGKSTVLSETLPRGQCLLYNWEEERATNYLDQVPVMQDGSESFFFRHGHRGLLTLQPQSPTSSCTTQKDSYQPPKSHCQPIRGKREAILEMLLRQQICKEVQAEQEPTRKDSEVESVTHHDYKKELVQAGPPAPTKIHDYHTEQPETFWLERAPQLPGVSNIRTLDTPFRKNCSFSTPVPLSLEQPLPFEPESYSQHGEISSLACQGGGQGGGGG

Entity 41 Entity 41 polymer

Description description	Tubulin beta-4B chain
Molecular weight formula_weight	49877.8 kDa
Source method src_method	nat
Copy count entity_count	130

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;AB,AD,AF,AH,AJ,AL,BB,BD,BF,BH,BJ,BL,CB,CD,CF,CH,CJ,CL,DB,DD,DF,DH,DJ,DL,ED,EF,EH,EJ,EL,FD,FF,FH,FJ,FL,GD,GF,GH,GJ,GL,HB,HD,HF,HH,HJ,HL,ID,IF,IH,IJ,IL,IN,JD,JF,JH,JJ,JL,KD,KF,KH,KJ,KL,KN,LD,LF,LH,LJ,LL,LN,MD,MF,MH,MJ,ML,MN,NB,ND,NF,NH,NJ,NL,OB,OD,OF,OH,OJ,OL,PB,PD,PF,PH,PJ,PL,QB,QD,QF,QH,QJ,QL,RB,RD,RF,RH,RJ,RL,SD,SF,SH,SJ,SL,TD,TF,TH,TJ,TL,UD,UF,UH,UJ,UL,VD,VF,VH,VJ,VL,WD,WF,WH,WJ,WL,WN ;

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Entity 42 Entity 42 polymer

Description description	Tubulin alpha-1D chain
Molecular weight formula_weight	50335.6 kDa
Source method src_method	nat
Copy count entity_count	134

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;AC,AE,AG,AI,AK,BC,BE,BG,BI,BK,CC,CE,CG,CI,CK,CM,DC,DE,DG,DI,DK,DM,EC,EE,EG,EI,EK,EM,FC,FE,FG,FI,FK,FM,GC,GE,GG,GI,GK,GM,HC,HE,HG,HI,HK,HM,IC,IE,IG,II,IK,IM,JC,JE,JG,JI,JK,JM,KC,KE,KG,KI,KK,KM,LC,LE,LG,LI,LK,LM,MC,ME,MG,MI,MK,MM,NA,NC,NE,NG,NI,NK,OA,OC,OE,OG,OI,OK,PA,PC,PE,PG,PI,PK,QC,QE,QG,QI,QK,RC,RE,RG,RI,RK,SC,SE,SG,SI,SK,SM,TC,TE,TG,TI,TK,TM,UC,UE,UG,UI,UK,UM,VC,VE,VG,VI,VK,VM,WC,WE,WG,WI,WK,WM ;

MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGMDSVEGEGEEEEGDEY

Entity 43 Entity 43 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	130

Entity 44 Entity 44 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	106

Entity 45 Entity 45 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	134

▶

Resolution resolution	3.52 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	153589

Atomic model of bovine Fallopian tube cilia doublet microtubule (48-nm periodicity)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Armadillo repeat containing 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Coiled-coil domain containing 114

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Coiled-coil domain containing 173

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein C1orf158 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein Flattop

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CFAP141

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cilia and flagella associated protein 161

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cilia- and flagella-associated protein 20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EF-hand domain family member B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CFAP276

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer