8ovu

Human titin immunoglobulin-like 21 domain

Method: X-RAY DIFFRACTION D_max: 69.5 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Titin

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 3500–3598	Not recorded	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.06 M divalent ions (CaCl2, MgCl2), 0.1 M sodium HEPES, pH 7.5, 50% v/v Polyethylene glycol monomethyl ether (PEGMME) 550, PEG 20K from Morpheus HT-96 screening plate (Molecular Dimensions)	Resolution 1.95 Å R-free 0.239
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 3500–3598	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.06 M divalent ions (CaCl2, MgCl2), 0.1 M sodium HEPES, pH 7.5, 50% v/v Polyethylene glycol monomethyl ether (PEGMME) 550, PEG 20K from Morpheus HT-96 screening plate (Molecular Dimensions)	Resolution 1.95 Å R-free 0.239

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8OVU	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1TNM TERTIARY STRUCTURE OF AN IMMUNOGLOBULIN-LIKE DOMAIN FROM THE GIANT MUSCLE PROTEIN TITIN: A NEW MEMBER OF THE I SET Deposited 1995-01-17	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 33489–33579（91 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1TNN Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the I set Deposited 1995-01-17	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 33489–33579（91 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1WAA IG27 protein domain Deposited 2004-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 12801–12889（89 aa） Fragment：IG DOMAIN, RESIDUES 12801-12889 Chain B 12801–12889（89 aa） Fragment：IG DOMAIN, RESIDUES 12801-12889 Chain C 12801–12889（89 aa） Fragment：IG DOMAIN, RESIDUES 12801-12889 Chain D 12801–12889（89 aa） Fragment：IG DOMAIN, RESIDUES 12801-12889 Chain E 12801–12889（89 aa） Fragment：IG DOMAIN, RESIDUES 12801-12889 Chain F 12801–12889（89 aa） Fragment：IG DOMAIN, RESIDUES 12801-12889	Not recorded	ZN ZINC ION × 24	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.268
2A38 Crystal structure of the N-Terminus of titin Deposited 2005-06-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–194（194 aa） Fragment：Ig-like 1/2, residues 1-194	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；MES, Cadmium sulphate, Sodium acetate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.255
2A38 Crystal structure of the N-Terminus of titin Deposited 2005-06-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–194（194 aa） Fragment：Ig-like 1/2, residues 1-194	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；MES, Cadmium sulphate, Sodium acetate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.255
2A38 Crystal structure of the N-Terminus of titin Deposited 2005-06-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–194（194 aa） Fragment：Ig-like 1/2, residues 1-194	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；MES, Cadmium sulphate, Sodium acetate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.255
2BK8 M1 domain from titin Deposited 2005-02-11	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 32497–32590（94 aa） Fragment：RESIDUES 25073-25166 (IG-LIKE DOMAIN)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；2.2 M AMMONIUM SULFATE 0.1 M BIS TRIS PH 7.0	Resolution 1.69 Å R-free 0.234
2F8V Structure of full length telethonin in complex with the N-terminus of titin Deposited 2005-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–196（196 aa） Fragment：Domains Z1Z2, residues 1-196 Chain B 1–196（196 aa） Fragment：Domains Z1Z2, residues 1-196	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.45；298 K；PEG35000, LITHIUM SULPHATE, ACETATE BUFFER, pH 4.45, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.75 Å R-free 0.287
2F8V Structure of full length telethonin in complex with the N-terminus of titin Deposited 2005-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–196（196 aa） Fragment：Domains Z1Z2, residues 1-196 Chain D 1–196（196 aa） Fragment：Domains Z1Z2, residues 1-196	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.45；298 K；PEG35000, LITHIUM SULPHATE, ACETATE BUFFER, pH 4.45, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.75 Å R-free 0.287
2ILL Anomalous substructure of Titin-A168169 Deposited 2006-10-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 31854–32047（194 aa） Fragment：Titin-A168169	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.243
2J8H Structure of the immunoglobulin tandem repeat A168-A169 of titin Deposited 2006-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 24430–24623（194 aa） Fragment：IG LIKE DOMAIN, RESIDUES 24430-24623	Not recorded	GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；AMMONIUM SULFATE, BICINE, pH 9	Resolution 1.99 Å R-free 0.210
2J8O Structure of the immunoglobulin tandem repeat of titin A168-A169 Deposited 2006-10-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24430–24623（194 aa） Fragment：IG LIKE DOMAIN, RESIDUES 24430-24623	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；AMMONIUM SULFATE, BICINE, pH 9	Resolution 2.49 Å R-free 0.300
2J8O Structure of the immunoglobulin tandem repeat of titin A168-A169 Deposited 2006-10-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 24430–24623（194 aa） Fragment：IG LIKE DOMAIN, RESIDUES 24430-24623	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；AMMONIUM SULFATE, BICINE, pH 9	Resolution 2.49 Å R-free 0.300
2NZI Crystal structure of domains A168-A170 from titin Deposited 2006-11-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 31854–32155（302 aa） Fragment：Residues 31854-32155	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；2.1M NaCl, 0.1M MES, 0.6M Li2SO4, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.90 Å R-free 0.274
2NZI Crystal structure of domains A168-A170 from titin Deposited 2006-11-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 31854–32155（302 aa） Fragment：Residues 31854-32155	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；2.1M NaCl, 0.1M MES, 0.6M Li2SO4, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.90 Å R-free 0.274
2RQ8 Solution NMR structure of titin I27 domain mutant Deposited 2009-03-05	Different construct Different mutation/modification Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 12677–12765（89 aa） Fragment：UNP residues 12677-12765	Mutation：K3E, Y9P, T42A, A78T	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298 K；Ionic strength (raw mmCIF value) 50mM POTASSIUM PHOSPHATE；Pressure 1 NMR sample composition 1.0mM TITIN I27 mutant, 50mM potassium phosphate buffer, 99.9% D2O \| 99.9% D2O NMR sample composition 1.0mM [U-15N] TITIN I27 mutant, 50mM potassium phosphate buffer, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1.0mM [U-13C; U-15N] TITIN I27 mutant, 50mM potassium phosphate buffer, 99.9% D2O \| 99.9% D2O	Resolution not provided
2WP3 Crystal structure of the Titin M10-Obscurin like 1 Ig complex Deposited 2009-08-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain T 34252–34350（99 aa） Fragment：M10, RESIDUES 34252-34350	Not recorded	GOL GLYCEROL × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；PROTEIN COMPLEX AT 13 MG/ML 2M AMM SULPHATE, 0.1 M BIS-TRIS PH 5.5	Resolution 1.48 Å R-free 0.217
2WWK Crystal structure of the Titin M10-Obscurin like 1 Ig F17R mutant complex Deposited 2009-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain T 34252–34350（99 aa） Fragment：M10, RESIDUES 34252-34350	Not recorded	GOL GLYCEROL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；0.1 M BIS-TRIS PH 5.5, 0.2 M AMMONIUM SULPHATE, 25% PEG 3350	Resolution 1.70 Å R-free 0.259
2WWM Crystal structure of the Titin M10-Obscurin like 1 Ig complex in space group P1 Deposited 2009-10-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain T 34252–34350（99 aa） Fragment：M10, RESIDUES 34252-34350	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5；0.1 M MIB BUFFER PH 5.0, 25% PEG 1500	Resolution 2.30 Å R-free 0.252
2WWM Crystal structure of the Titin M10-Obscurin like 1 Ig complex in space group P1 Deposited 2009-10-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 34252–34350（99 aa） Fragment：M10, RESIDUES 34252-34350	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5；0.1 M MIB BUFFER PH 5.0, 25% PEG 1500	Resolution 2.30 Å R-free 0.252
2Y9R Crystal structure of the M10 domain of Titin Deposited 2011-02-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain T 26828–26926（99 aa） Fragment：M10 DOMAIN, RESIDUES 26828-26926	Not recorded	12P DODECAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；35% PEG 400, 0.1M BIS-TRIS PH 6.5	Resolution 1.90 Å R-free 0.241
3KNB Crystal structure of the titin C-terminus in complex with obscurin-like 1 Deposited 2009-11-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 34253–34350（98 aa） Fragment：titin, C-terminal domain M10, resideus 34253-34350	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；ammonium sulfate, imidazole, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.40 Å R-free 0.195
3LCY Titin Ig tandem domains A164-A165 Deposited 2010-01-12	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 31456–31649（194 aa） Fragment：Titin A-band tandem Ig domains A164-A165	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M Hepes PH 7.5, 10% iso-propanol 8.5% PEG20,000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.240
3LCY Titin Ig tandem domains A164-A165 Deposited 2010-01-12	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 31456–31649（194 aa） Fragment：Titin A-band tandem Ig domains A164-A165	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M Hepes PH 7.5, 10% iso-propanol 8.5% PEG20,000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.240
3LCY Titin Ig tandem domains A164-A165 Deposited 2010-01-12	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 31456–31649（194 aa） Fragment：Titin A-band tandem Ig domains A164-A165	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M Hepes PH 7.5, 10% iso-propanol 8.5% PEG20,000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.240
3LCY Titin Ig tandem domains A164-A165 Deposited 2010-01-12	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 31456–31649（194 aa） Fragment：Titin A-band tandem Ig domains A164-A165	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M Hepes PH 7.5, 10% iso-propanol 8.5% PEG20,000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.240
3LPW Crystal structure of the FnIII-tandem A77-A78 from the A-band of titin Deposited 2010-02-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 22877–23070（194 aa）	Not recorded	MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1 MRD (4R)-2-METHYLPENTANE-2,4-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.65 Å R-free 0.208
3LPW Crystal structure of the FnIII-tandem A77-A78 from the A-band of titin Deposited 2010-02-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 22877–23070（194 aa）	Not recorded	MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.65 Å R-free 0.208
3PUC Atomic resolution structure of titin domain M7 Deposited 2010-12-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 33774–33871（98 aa） Fragment：domain M7 (UNP RESIDUES 33774-33871)	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；0.1M Tris pH 8.0, 3.2M ammonium sulfate, 1mM TCEP, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 0.96 Å R-free 0.135
3Q5O Crystal structure of human titin domain M10 Deposited 2010-12-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 34253–34350（98 aa） Fragment：domain M10 (UNP RESIDUES 34253-34350)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；0.1M bistris p 6.8, 55% MPD, 0.2M magnesium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.05 Å R-free 0.215
3Q5O Crystal structure of human titin domain M10 Deposited 2010-12-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 34253–34350（98 aa） Fragment：domain M10 (UNP RESIDUES 34253-34350)	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；0.1M bistris p 6.8, 55% MPD, 0.2M magnesium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.05 Å R-free 0.215
3QP3 Crystal structure of titin domain M4, tetragonal form Deposited 2011-02-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 33294–33395（102 aa） Fragment：domain M4 (UNP RESIDUES 33294-33395)	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；293 K；0.2M Na-citrate pH 4.0, 1.2M (NH4)2SO4, 0.3M MgSO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.213
3QP3 Crystal structure of titin domain M4, tetragonal form Deposited 2011-02-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 33294–33395（102 aa） Fragment：domain M4 (UNP RESIDUES 33294-33395)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；293 K；0.2M Na-citrate pH 4.0, 1.2M (NH4)2SO4, 0.3M MgSO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.213
3QP3 Crystal structure of titin domain M4, tetragonal form Deposited 2011-02-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 33294–33395（102 aa） Fragment：domain M4 (UNP RESIDUES 33294-33395)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；293 K；0.2M Na-citrate pH 4.0, 1.2M (NH4)2SO4, 0.3M MgSO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.213
4C4K Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2013-09-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain T 34252–34350（99 aa） Fragment：M10 DOMAIN, RESIDUES 34252-34350	Not recorded	EDO 1,2-ETHANEDIOL × 12	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1 M TRIS-HCL PH 8.5, 0.2 M SODIUM ACETATE, 30% PEG4000	Resolution 1.95 Å R-free 0.210
4JNW Bacterially expressed Titin Kinase Deposited 2013-03-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 32172–32492（321 aa） Fragment：titin kinase: unp residues 32172-32492	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；VAPOR DIFFUSION, HANGING DROP	Resolution 2.06 Å R-free 0.204
4JNW Bacterially expressed Titin Kinase Deposited 2013-03-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 32172–32492（321 aa） Fragment：titin kinase: unp residues 32172-32492	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；VAPOR DIFFUSION, HANGING DROP	Resolution 2.06 Å R-free 0.204
4O00 Crystal structure of the Titin A-band domain A3 Deposited 2013-12-13	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 14217–14319（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；291 K；0.1M SPG buffer, 0.01M Tris-HCl, 31% PEG1500, 50mM NaCl, 1mM DTT, pH 4.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.85 Å R-free 0.208
4O00 Crystal structure of the Titin A-band domain A3 Deposited 2013-12-13	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 14217–14319（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；291 K；0.1M SPG buffer, 0.01M Tris-HCl, 31% PEG1500, 50mM NaCl, 1mM DTT, pH 4.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.85 Å R-free 0.208
4QEG Crystal structure of domain I10 from titin (space group P41) Deposited 2014-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2880–2967（88 aa） Fragment：domain I10	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；0.2 M CaCl2, 30% PEG 3350, 0.1 M Tris, 3% Isopropanol, pH 7.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.00 Å R-free 0.231
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain Y 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 12 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain U 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 13 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 14 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain Q 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 15 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain W 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 16 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain 2 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 17 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 18 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain 8 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain 6 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain 0 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
4UOW Crystal structure of the titin M10-Obscurin Ig domain 1 complex Deposited 2014-06-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain 4 34253–34349（97 aa） Fragment：FIRST IG DOMAIN, RESIDUES 26829-26925	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 3.6；291 K；3.0 M SODIUM CHLORIDE 0.1 M TRI-SODIUM CITRATE PH 3.6 BATCH SETUP	Resolution 3.30 Å R-free 0.210
5BS0 MAGE-A3 Reactive TCR in complex with Titin Epitope in HLA-A1 Deposited 2015-06-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 24337–24345（9 aa） Fragment：UNP residues 24337-24345	Not recorded	GOL GLYCEROL × 1 SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.2M Ammonium Chloride, 0.1M MES, 20% PEG 4000	Resolution 2.40 Å R-free 0.262
5JDD Crystal structure of I9-I11 tandem from titin (P212121) Deposited 2016-04-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2795–3053（259 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292 K；0.1 M Bis-Tris Propane pH 8.5, 20% [w/v] PEG 3350, 0.2 M sodium acetate	Resolution 1.53 Å R-free 0.197
5JDE Crystal structure of I9-I11 tandem from titin (P1) Deposited 2016-04-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2795–3053（259 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292 K；0.1 M Tris HCl pH 8.5, 30% [w/v] PEG 4000, 0.2 M MgCl2	Resolution 1.90 Å R-free 0.219
5JDE Crystal structure of I9-I11 tandem from titin (P1) Deposited 2016-04-16	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2795–3053（259 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；292 K；0.1 M Tris HCl pH 8.5, 30% [w/v] PEG 4000, 0.2 M MgCl2	Resolution 1.90 Å R-free 0.219
5JDJ Crystal structure of domain I10 from titin in space group P212121 Deposited 2016-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2880–2967（88 aa） Chain L 2880–2967（88 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.2 M CaCl2, 0.1 M Tris pH 7.5, 25% [w/v] PEG 8000	Resolution 1.74 Å R-free 0.224
5JDJ Crystal structure of domain I10 from titin in space group P212121 Deposited 2016-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 2880–2967（88 aa） Chain P 2880–2967（88 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.2 M CaCl2, 0.1 M Tris pH 7.5, 25% [w/v] PEG 8000	Resolution 1.74 Å R-free 0.224
5JDJ Crystal structure of domain I10 from titin in space group P212121 Deposited 2016-04-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 2880–2967（88 aa） Chain M 2880–2967（88 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.2 M CaCl2, 0.1 M Tris pH 7.5, 25% [w/v] PEG 8000	Resolution 1.74 Å R-free 0.224
5JDJ Crystal structure of domain I10 from titin in space group P212121 Deposited 2016-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain D 2880–2967（88 aa） Chain E 2880–2967（88 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.2 M CaCl2, 0.1 M Tris pH 7.5, 25% [w/v] PEG 8000	Resolution 1.74 Å R-free 0.224
5JDJ Crystal structure of domain I10 from titin in space group P212121 Deposited 2016-04-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain F 2880–2967（88 aa） Chain N 2880–2967（88 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.2 M CaCl2, 0.1 M Tris pH 7.5, 25% [w/v] PEG 8000	Resolution 1.74 Å R-free 0.224
5JDJ Crystal structure of domain I10 from titin in space group P212121 Deposited 2016-04-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 2880–2967（88 aa） Chain J 2880–2967（88 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.2 M CaCl2, 0.1 M Tris pH 7.5, 25% [w/v] PEG 8000	Resolution 1.74 Å R-free 0.224
5JDJ Crystal structure of domain I10 from titin in space group P212121 Deposited 2016-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain H 2880–2967（88 aa） Chain I 2880–2967（88 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.2 M CaCl2, 0.1 M Tris pH 7.5, 25% [w/v] PEG 8000	Resolution 1.74 Å R-free 0.224
5JDJ Crystal structure of domain I10 from titin in space group P212121 Deposited 2016-04-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 8 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain K 2880–2967（88 aa） Chain O 2880–2967（88 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.2 M CaCl2, 0.1 M Tris pH 7.5, 25% [w/v] PEG 8000	Resolution 1.74 Å R-free 0.224
5JOE Crystal structure of I81 from titin Deposited 2016-05-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 9582–9671（90 aa） Fragment：I81 domain	Not recorded	IPA ISOPROPYL ALCOHOL × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；292.15 K；0.1M Tris pH 8.5; 30% w/v PEG 4000	Resolution 2.00 Å R-free 0.218
6DL4 Human Titin ZIg10 Deposited 2018-05-31	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1821–1931（111 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；298 K；Ionic strength (raw mmCIF value) 50；Pressure 1 NMR sample composition 20 mM TRIS, 50 mM sodium chloride, 1 mM [U-99% 13C; U-99% 15N] Human Titin ZIg10, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6FWX Chimeric titin Z1Z2-Z1Z2 tandem (Z1212) functionalized with a GRGDS exogenous peptide from fibronectin Deposited 2018-03-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Chain A 2–47（46 aa） Chain A 52–196（145 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10% [v/v] isopropanol, 100 mM Na2HPO4 pH 4.2, 200 mM LiSO4	Resolution 3.00 Å R-free 0.226
6FWX Chimeric titin Z1Z2-Z1Z2 tandem (Z1212) functionalized with a GRGDS exogenous peptide from fibronectin Deposited 2018-03-07	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–196（196 aa） Chain B 2–47（46 aa） Chain B 52–196（145 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10% [v/v] isopropanol, 100 mM Na2HPO4 pH 4.2, 200 mM LiSO4	Resolution 3.00 Å R-free 0.226
6H4L Structure of Titin M4 trigonal form Deposited 2018-07-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 33294–33395（102 aa）	Not recorded	ZN ZINC ION × 1 CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；MES pH 6.5 2M RbBr	Resolution 1.60 Å R-free 0.221
6HCI Crystal structure of titin M3 domain Deposited 2018-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 32712–32816（105 aa） Chain B 32712–32816（105 aa） Chain C 32712–32816（105 aa） Chain D 32712–32816（105 aa）	Not recorded	SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；0.2 M ammonium sulfate 23% w/v polyethylene glycol 4000	Resolution 2.12 Å R-free 0.245
6I0Y TnaC-stalled ribosome complex with the titin I27 domain folding close to the ribosomal exit tunnel Deposited 2018-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 36-meric	Chain z 14318–14406（89 aa）	Not recorded	MG MAGNESIUM ION × 143 ZN ZINC ION × 1 TRP TRYPTOPHAN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6SDB Chimeric titin Z1Z2 functionalized with a KLER exogenous peptide from decorin Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3–45（43 aa） Chain A 51–196（146 aa）	Not recorded	ACT ACETATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；1 M NH4H2PO4 pH 4.6, 100 mM sodium acetate	Resolution 2.80 Å R-free 0.234
6SDB Chimeric titin Z1Z2 functionalized with a KLER exogenous peptide from decorin Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 3–45（43 aa） Chain B 51–196（146 aa）	Not recorded	ACT ACETATE ION × 1 SO4 SULFATE ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；1 M NH4H2PO4 pH 4.6, 100 mM sodium acetate	Resolution 2.80 Å R-free 0.234
6SDB Chimeric titin Z1Z2 functionalized with a KLER exogenous peptide from decorin Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 3–45（43 aa） Chain C 51–196（146 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；1 M NH4H2PO4 pH 4.6, 100 mM sodium acetate	Resolution 2.80 Å R-free 0.234
6SDB Chimeric titin Z1Z2 functionalized with a KLER exogenous peptide from decorin Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain D 3–45（43 aa） Chain D 51–196（146 aa）	Not recorded	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；1 M NH4H2PO4 pH 4.6, 100 mM sodium acetate	Resolution 2.80 Å R-free 0.234
6SDB Chimeric titin Z1Z2 functionalized with a KLER exogenous peptide from decorin Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain E 3–45（43 aa） Chain E 51–196（146 aa）	Not recorded	ACT ACETATE ION × 3 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；1 M NH4H2PO4 pH 4.6, 100 mM sodium acetate	Resolution 2.80 Å R-free 0.234
6YGN Titin kinase and its flanking domains Deposited 2020-03-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30596–31144（549 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；30% PEG 8K, 0.1 MES pH6.5	Resolution 2.40 Å R-free 0.228
6YGN Titin kinase and its flanking domains Deposited 2020-03-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 30596–31144（549 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；30% PEG 8K, 0.1 MES pH6.5	Resolution 2.40 Å R-free 0.228
7AHS titin-N2A Ig81-Ig83 Deposited 2020-09-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 9582–9851（270 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；25 % w/v Polyethylene glycol 3,350, 100 mM BIS-TRIS pH 5.5, 200 mM lithium sulfate	Resolution 2.05 Å R-free 0.235
7AHS titin-N2A Ig81-Ig83 Deposited 2020-09-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 9582–9851（270 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 7 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；25 % w/v Polyethylene glycol 3,350, 100 mM BIS-TRIS pH 5.5, 200 mM lithium sulfate	Resolution 2.05 Å R-free 0.235
7AHS titin-N2A Ig81-Ig83 Deposited 2020-09-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 9582–9851（270 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3 SO4 SULFATE ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；25 % w/v Polyethylene glycol 3,350, 100 mM BIS-TRIS pH 5.5, 200 mM lithium sulfate	Resolution 2.05 Å R-free 0.235
7AHS titin-N2A Ig81-Ig83 Deposited 2020-09-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 9582–9851（270 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；25 % w/v Polyethylene glycol 3,350, 100 mM BIS-TRIS pH 5.5, 200 mM lithium sulfate	Resolution 2.05 Å R-free 0.235
7NIP titin N2A unique sequence (UN2A) core Deposited 2021-02-13	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 8578–8617（40 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；298 K；Ionic strength (raw mmCIF value) 100；Pressure 101300 NMR sample composition 30 mM sodium phosphate, 100 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
8BNQ Crystal structure of the FnIII-tandem A84-A86 from the A-band of titin Deposited 2022-11-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 23562–23862（301 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；5% [v/v] polyethylene glycol 400 and 40% [v/v] 2-methyl-2,4-pentanediol (MPD)	Resolution 2.30 Å R-free 0.258
8BNQ Crystal structure of the FnIII-tandem A84-A86 from the A-band of titin Deposited 2022-11-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 23562–23862（301 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；5% [v/v] polyethylene glycol 400 and 40% [v/v] 2-methyl-2,4-pentanediol (MPD)	Resolution 2.30 Å R-free 0.258
8BVO Titin I110-I111 FnIII tandem from the MIR region (I/A5-I/A6) Deposited 2022-12-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 14415–14609（195 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291.15 K；24% (w/v) PEG 1500, 20% (w/v) glycerol	Resolution 2.55 Å R-free 0.287
8BW6 Titin FnIII-domain I110 (I/A6) from the MIR region Deposited 2022-12-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 14415–14509（95 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 7 PEG DI(HYDROXYETHYL)ETHER × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291.15 K；0.1M Tris pH8 30% PEG 300	Resolution 1.95 Å R-free 0.254
8BXR Titin FnIII-domain I109-I111 (I/A4-A/A6) from the MIR region Deposited 2022-12-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 14319–14615（297 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291.15 K；0.1M MES pH 6, 10% [w/v] PEG 6000	Resolution 2.70 Å R-free 0.271
8G4L Cryo-EM structure of the human cardiac myosin filament Deposited 2023-02-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 123 PDB declaration: 123-meric	Chain am 22784–23867（1084 aa） Chain an 22784–23867（1084 aa） Chain bm 22784–23867（1084 aa） Chain bn 22784–23867（1084 aa） Chain m 22784–23867（1084 aa） Chain n 22784–23867（1084 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
8OIY Crystal structure of the R15908H missense variant of titin domain Fn3-3 Deposited 2023-03-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 14217–14319（103 aa） Chain B 14217–14319（103 aa） Chain C 14217–14319（103 aa） Chain D 14217–14319（103 aa） Chain E 14217–14319（103 aa） Chain F 14217–14319（103 aa）	Mutation：R15908H Mutation：R15908H Mutation：R15908H Mutation：R15908H Mutation：R15908H Mutation：R15908H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；10mM Tris-HCl PH 7.5 NaCl 0.5mM DTT 0.1M sodium acetate pH 4.5 0.2M Lithium sulphate 50% v/v PEG 400	Resolution 2.10 Å R-free 0.257
8OMW Crystal structure of the titin domain Fn3-20 Deposited 2023-03-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 16525–16630（106 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10mM Tris-HCl pH 7.5 50mM NaCl 0.5mM DTT 0.1M TBG pH 9.0 25% w/v PEG 1500	Resolution 1.05 Å R-free 0.177
8OQ9 Crystal structure of the titin domain Fn3-56 Deposited 2023-04-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 21497–21598（102 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10mM Tris-HCl pH 7.5 50mM NaCl 0.5mM DTT 0.1M MES 10mM ZnCl2 20% (w/v) PEG6000	Resolution 1.65 Å R-free 0.192
8OQ9 Crystal structure of the titin domain Fn3-56 Deposited 2023-04-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 21497–21598（102 aa）	Not recorded	ZN ZINC ION × 3 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10mM Tris-HCl pH 7.5 50mM NaCl 0.5mM DTT 0.1M MES 10mM ZnCl2 20% (w/v) PEG6000	Resolution 1.65 Å R-free 0.192
8OQ9 Crystal structure of the titin domain Fn3-56 Deposited 2023-04-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 21497–21598（102 aa）	Not recorded	ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10mM Tris-HCl pH 7.5 50mM NaCl 0.5mM DTT 0.1M MES 10mM ZnCl2 20% (w/v) PEG6000	Resolution 1.65 Å R-free 0.192
8ORL Crystal structure of the S23226G missense variant of titin domain Fn3-56 Deposited 2023-04-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 21497–21598（102 aa）	Not recorded	ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10mM Tris-HCl pH 7.5 50mM NaCl 0.5mM DTT 0.1M MES 10mM ZnCl2 20% (w/v) PEG6000	Resolution 1.43 Å R-free 0.194
8ORL Crystal structure of the S23226G missense variant of titin domain Fn3-56 Deposited 2023-04-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 21497–21598（102 aa）	Not recorded	ZN ZINC ION × 3 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10mM Tris-HCl pH 7.5 50mM NaCl 0.5mM DTT 0.1M MES 10mM ZnCl2 20% (w/v) PEG6000	Resolution 1.43 Å R-free 0.194
8ORL Crystal structure of the S23226G missense variant of titin domain Fn3-56 Deposited 2023-04-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 21497–21598（102 aa）	Not recorded	ZN ZINC ION × 1 CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10mM Tris-HCl pH 7.5 50mM NaCl 0.5mM DTT 0.1M MES 10mM ZnCl2 20% (w/v) PEG6000	Resolution 1.43 Å R-free 0.194
8OS3 Crystal structure of the titin domain Fn3-11 Deposited 2023-04-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 15210–15313（104 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 50mM NaCl 0.5mM DTT 100mM sodium acetate pH 4.5 200mM Lithium sulphate 50% v/v PEG 400	Resolution 1.68 Å R-free 0.208
8OSD Crystal structure of the titin domain Fn3-49 Deposited 2023-04-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20511–20616（106 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Potassium thiocyanate 30% w/v PEG MME2000	Resolution 1.70 Å R-free 0.260
8OSD Crystal structure of the titin domain Fn3-49 Deposited 2023-04-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 20511–20616（106 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Potassium thiocyanate 30% w/v PEG MME2000	Resolution 1.70 Å R-free 0.260
8OT5 Crystal structure of the titin domain Fn3-85 Deposited 2023-04-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 25430–25531（102 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Bis-Tris propane pH 6.5 200mM sodium iodide 20% w/v PEG3350	Resolution 1.56 Å R-free 0.191
8OT5 Crystal structure of the titin domain Fn3-85 Deposited 2023-04-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 25430–25531（102 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Bis-Tris propane pH 6.5 200mM sodium iodide 20% w/v PEG3350	Resolution 1.56 Å R-free 0.191
8OT5 Crystal structure of the titin domain Fn3-85 Deposited 2023-04-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 25430–25531（102 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Bis-Tris propane pH 6.5 200mM sodium iodide 20% w/v PEG3350	Resolution 1.56 Å R-free 0.191
8OT5 Crystal structure of the titin domain Fn3-85 Deposited 2023-04-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 25430–25531（102 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Bis-Tris propane pH 6.5 200mM sodium iodide 20% w/v PEG3350	Resolution 1.56 Å R-free 0.191
8OT5 Crystal structure of the titin domain Fn3-85 Deposited 2023-04-20	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 25430–25531（102 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Bis-Tris propane pH 6.5 200mM sodium iodide 20% w/v PEG3350	Resolution 1.56 Å R-free 0.191
8OT5 Crystal structure of the titin domain Fn3-85 Deposited 2023-04-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 25430–25531（102 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Bis-Tris propane pH 6.5 200mM sodium iodide 20% w/v PEG3350	Resolution 1.56 Å R-free 0.191
8OTY Crystal structure of the titin domain Fn3-90 Deposited 2023-04-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 26124–26224（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Sodium acetate 200mM CaCl 20% w/v PEG6000	Resolution 1.90 Å R-free 0.251
8OTY Crystal structure of the titin domain Fn3-90 Deposited 2023-04-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 26124–26224（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Sodium acetate 200mM CaCl 20% w/v PEG6000	Resolution 1.90 Å R-free 0.251
8OTY Crystal structure of the titin domain Fn3-90 Deposited 2023-04-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 26124–26224（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Sodium acetate 200mM CaCl 20% w/v PEG6000	Resolution 1.90 Å R-free 0.251
8OTY Crystal structure of the titin domain Fn3-90 Deposited 2023-04-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 26124–26224（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；30mM HEPES pH 7.5 150mM NaCl 1mM DTT 100mM Sodium acetate 200mM CaCl 20% w/v PEG6000	Resolution 1.90 Å R-free 0.251
8P35 Mutant human titin immunoglobulin-like 21 domain - C3575S Deposited 2023-05-17	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3500–3598（99 aa）	Mutation：C3575S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES sodium salt, pH 7.5, 25 %(w/v) PEG 2000 MME	Resolution 2.20 Å R-free 0.250
8P35 Mutant human titin immunoglobulin-like 21 domain - C3575S Deposited 2023-05-17	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 3500–3598（99 aa）	Mutation：C3575S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES sodium salt, pH 7.5, 25 %(w/v) PEG 2000 MME	Resolution 2.20 Å R-free 0.250
8P35 Mutant human titin immunoglobulin-like 21 domain - C3575S Deposited 2023-05-17	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 3500–3598（99 aa）	Mutation：C3575S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES sodium salt, pH 7.5, 25 %(w/v) PEG 2000 MME	Resolution 2.20 Å R-free 0.250
8P35 Mutant human titin immunoglobulin-like 21 domain - C3575S Deposited 2023-05-17	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 3500–3598（99 aa）	Mutation：C3575S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES sodium salt, pH 7.5, 25 %(w/v) PEG 2000 MME	Resolution 2.20 Å R-free 0.250
8P35 Mutant human titin immunoglobulin-like 21 domain - C3575S Deposited 2023-05-17	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 3500–3598（99 aa）	Mutation：C3575S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES sodium salt, pH 7.5, 25 %(w/v) PEG 2000 MME	Resolution 2.20 Å R-free 0.250
8P35 Mutant human titin immunoglobulin-like 21 domain - C3575S Deposited 2023-05-17	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 3500–3598（99 aa）	Mutation：C3575S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.1 M HEPES sodium salt, pH 7.5, 25 %(w/v) PEG 2000 MME	Resolution 2.20 Å R-free 0.250

54 other PDB entries and 122 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TITIN_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–99； UniProt 3500–3598 Author chain B； PDBConstruct 1–99； UniProt 3500–3598

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ovu
Deposition date deposition_date	2023-04-26
Structure title title	Human titin immunoglobulin-like 21 domain
Keywords keywords	Titin, Muscle, Immunoglobulin-like, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	19.31 Å
Radius of gyration Rg (electron density) rg_electron	18.45 Å
Forward intensity I(0) i0	7921220.00
Molecular weight molecular_weight	21499.0 kDa
Excluded volume excluded_volume	27237 Å³
Envelope volume envelope_volume	32578 Å³
Hydration-shell volume shell_volume	15587 Å³
Envelope diameter envelope_diameter	71.1 Å
Shell Rg shell_rg	23.74 Å
Envelope Rg envelope_rg	18.79 Å
Shape Rg shape_rg	18.43 Å
Total Rg total_rg	19.40 Å
Total atoms total_atoms	3009
Residues n_residues	198
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	69.5 Å
Rg (real space) rg_real	19.35 Å
Rg uncertainty (real space) rg_real_error	0.62 Å
I(0) (real space) i0_real	7.9210e+06
I(0) uncertainty (real space) i0_real_error	1.0080e+05
Rg (reciprocal space) rg_reciprocal	19.34 Å
I(0) (reciprocal space) i0_reciprocal	7921000.0000
Solution quality estimate total_estimate	0.7728
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	23.5 Å
Skewness Skewness skewness	0.427
Kurtosis Kurtosis kurtosis	-0.053
Angular range angular_range	— – 0.4100 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1522000.0000
Real-space data points n_real_points	72
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.729; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.854; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Titin
Molecular weight formula_weight	10768.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3198

GTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEG

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	189

▶

8. Citations (1)

▶

Unit-cell length a length_a	36.370 Å
Unit-cell length b length_b	62.163 Å
Unit-cell length c length_c	189.667 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	orthorhombic

Resolution resolution	1.950 Å
Low-resolution limit resolution_low	31.390 Å
R factor r_factor	0.1912
R_work r_work	0.1888
R_free r_free	0.2390

fit	/app/data/saxs_computation/ov/8ovu/8ovu.fit
pddf	/app/data/pr_computation/ov/8ovu/8ovu.pr.out
profile	/app/data/saxs_computation/ov/8ovu/8ovu.dat