8peq

Complex of diubiquitin-derived artificial binding protein (Affilin) variant Af2 with its target oncofetal fibronectin (fragment 7B8)

Method: X-RAY DIFFRACTION D_max: 128.1 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fibronectin

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1174–1447	Not recorded	Affilin variant Af2 × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 7.3；298 K；500 mM lithium sulfate, 15% PEG 8000 (w/v)	Resolution 2.32 Å R-free 0.251
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1174–1447	Not recorded	Affilin variant Af2 × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 7.3；298 K；500 mM lithium sulfate, 15% PEG 8000 (w/v)	Resolution 2.32 Å R-free 0.251
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 1174–1447	Not recorded	Affilin variant Af2 × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 7.3；298 K；500 mM lithium sulfate, 15% PEG 8000 (w/v)	Resolution 2.32 Å R-free 0.251

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8PEQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1E88 Solution structure of 6F11F22F2, a compact three-module fragment of the gelatin-binding domain of human fibronectin Deposited 2000-09-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 305–464（160 aa） Fragment：6F11F22F2, RESIDUES 305-464	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	SOLUTION NMR NMR measurement conditions pH 4.5；298 K NMR sample composition 2MM 6F11F22F2, 20MM PHOSPHATE BUFFER	Resolution not provided
1E8B Solution structure of 6F11F22F2, a compact three-module fragment of the gelatin-binding domain of human fibronectin Deposited 2000-09-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 305–464（160 aa） Fragment：6F11F22F2, RESIDUES 305-464	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	SOLUTION NMR NMR measurement conditions pH 4.5；298 K NMR sample composition 2MM 6F11F22F2, 20MM PHOSPHATE BUFFER	Resolution not provided
1FBR FOURTH AND FIFTH FIBRONECTIN TYPE I MODULE PAIR Deposited 1995-08-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 183–275（93 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1FNA CRYSTAL STRUCTURE OF THE TENTH TYPE III CELL ADHESION MODULE OF HUMAN FIBRONECTIN Deposited 1994-01-11	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1452–1542（91 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
1FNF FRAGMENT OF HUMAN FIBRONECTIN ENCOMPASSING TYPE-III REPEATS 7 THROUGH 10 Deposited 1995-09-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1173–1540（368 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；pH 5.8	Resolution 2.00 Å R-free 0.308
1FNH CRYSTAL STRUCTURE OF HEPARIN AND INTEGRIN BINDING SEGMENT OF HUMAN FIBRONECTIN Deposited 1999-01-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1721–1991（271 aa） Fragment：HEPARIN AND INTEGRIN BINDING	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；CRYSTALLIZATION CONDITIONS: 0.1M HEPES, PH7.5, 0.8M NA, K TARTRATE	Resolution 2.80 Å R-free 0.295
1J8K NMR STRUCTURE OF THE FIBRONECTIN EDA DOMAIN, NMR, 20 STRUCTURES Deposited 2001-05-22	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1631–1724（94 aa） Fragment：EXTRA DOMAIN 2 (RESIDUES 1631-1724)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；293 K；Ionic strength (raw mmCIF value) 400mM sodium sulfate；Pressure 1 NMR sample composition 2mM EDA U-15N,13C; 50mM phosphate buffer, 400mM sodium sulfate; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
1O9A Solution structure of the complex of 1F12F1 from fibronectin with B3 from FnBB from S. dysgalactiae Deposited 2002-12-11	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 48–140（93 aa） Fragment：N-TERMINAL F1 MODULE PAIR, RESIDUES 48-140	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5；298 K	Resolution not provided
1OWW Solution structure of the first type III module of human fibronectin determined by 1H, 15N NMR spectroscopy Deposited 2003-03-31	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 608–701（94 aa） Fragment：Residues 608-701 of SWS P02751	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；313 K；Ionic strength (raw mmCIF value) unbuffered；Pressure ambient NMR sample composition 1-2 mM [U-15N] protein, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
1Q38 Anastellin Deposited 2003-07-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 631–705（75 aa） Fragment：Type 3 (FN3) domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 150；Pressure ambient NMR sample composition 1.5 mM anastellin U-15N, 10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl, 2 mM CHAPS \| 90% H2O/10% D2O NMR sample composition 1.5 mM anastellin U-15N,13C, 10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, 2.7 mM KCl, 2 mM CHAPS \| 90% H2O/10% D2O	Resolution not provided
1QGB SOLUTION STRUCTURE OF THE N-TERMINAL F1 MODULE PAIR FROM HUMAN FIBRONECTIN Deposited 1999-04-21	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 48–140（93 aa） Fragment：N-TERMINAL F1 MODULE PAIR	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 4；310 K NMR sample composition 2.2 mM [U-15N] 1F1-2F1, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
1QO6 Solution structure of a pair of modules from the gelatin-binding domain of fibronectin Deposited 1999-11-04	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 305–405（101 aa） Fragment：FIBRONECTIN TYPE-I AND FIBRONECTIN TYPE-II MODULE PAIR FROM COLLAGEN-BINDING DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 4.5；310 K；Pressure 1	Resolution not provided
1TTF THE THREE-DIMENSIONAL STRUCTURE OF THE TENTH TYPE III MODULE OF FIBRONECTIN: AN INSIGHT INTO RGD-MEDIATED INTERACTIONS Deposited 1993-07-14	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1447–1540（94 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1TTG THE THREE-DIMENSIONAL STRUCTURE OF THE TENTH TYPE III MODULE OF FIBRONECTIN: AN INSIGHT INTO RGD-MEDIATED INTERACTIONS Deposited 1993-07-14	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1447–1540（94 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
2CG6 Second and third fibronectin type I module pair (crystal form I). Deposited 2006-02-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 93–182（90 aa） Fragment：RESIDUES 93-182 (62-151 IN COORDINATES)	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.5；0.2 M AMMONIUM SULPHATE, 0.1M NA ACETATE PH 4.5, 2% MPD, 5% PEG MME 550	Resolution 1.55 Å R-free 0.231
2CG7 SECOND AND THIRD FIBRONECTIN TYPE I MODULE PAIR (CRYSTAL FORM II). Deposited 2006-02-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 93–182（90 aa） Fragment：RESIDUES 93-182 (62-151 IN COORDINATES)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；WATER AND 0.02% SODIUM AZIDE, pH 7.00	Resolution 1.20 Å R-free 0.219
2CK2 Structure of core-swapped mutant of fibronectin Deposited 2006-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1447–1542（96 aa） Fragment：RESIDUES 1447-1542 Chain B 1447–1542（96 aa） Fragment：RESIDUES 1447-1542	Mutation：YES Mutation：YES	ACE ACETYL GROUP × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.1；50% PEG-400, 0.1 M ACTEATE, 0.2 M LITHIUM SULPHATE, PH 5.1	Resolution 2.00 Å R-free 0.268
2CKU Solution structure of 2F13F1 from human fibronectin Deposited 2006-04-21	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 93–182（90 aa） Fragment：2ND AND 3RD F1 MODULES, RESIDUES 93-182 (62-151 IN COORDINATES)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions 298 K	Resolution not provided
2EC3 Solution structure of the 11th FN1 domain from human Fibronectin 1 Deposited 2007-02-09	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2239–2299（61 aa） Fragment：Fibronectin type-I	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120mM；Pressure ambient NMR sample composition 1.14 mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2FN2 SOLUTION NMR STRUCTURE OF THE GLYCOSYLATED SECOND TYPE TWO MODULE OF FIBRONECTIN, 20 STRUCTURES Deposited 1997-08-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 375–433（59 aa） Fragment：RESIDUES 375 - 433	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	SOLUTION NMR NMR measurement conditions pH 4.5；298 K；Ionic strength (raw mmCIF value) 0 mM；Pressure 10E+5 PA NMR sample composition H2O/D2O(9:1) OR D2O	Resolution not provided
2FNB NMR STRUCTURE OF THE FIBRONECTIN ED-B DOMAIN, NMR, 20 STRUCTURES Deposited 1998-12-16	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1261–1355（95 aa） Fragment：TYPE III DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 63 mM；Pressure 1	Resolution not provided
2H41 Solution structure of the second type III domain of human Fibronectin: minimized average structure Deposited 2006-05-23	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 721–809（89 aa） Fragment：Fibronectin type-III 2(2F3)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；303 K；Ionic strength (raw mmCIF value) 20mM NaCl, 20mM Na2HPO4；Pressure ambient NMR sample composition 2.5mM 2F3 U-15N, 20mM NaPi pH 7.0, 20mM NaCl, 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 2mM 2F3 U-13C,15N, 20mM NaPi pH 7.0, 20mM NaCl, 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 2mM 2F3 U-13C,15N, 20mM NaPi pH 7.0, 20mM NaCl, 100% D2O \| 100% D2O NMR sample composition 1mM 2F3 U-15N, 20mM NaPi pH 7.0, 20mM NaCl, 4% Radially compressed polyacrylamide gel, 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2H45 Solution structure of the second type III domain of human Fibronectin: ensemble of 25 structures Deposited 2006-05-23	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 721–809（89 aa） Fragment：Fibronectin type-III 2(2F3)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；303 K；Ionic strength (raw mmCIF value) 20mM NaCl, 20mM Na2HPO4；Pressure ambient NMR sample composition 2.5mM 2F3 U-15N, 20mM NaPi pH 7.0, 20mM NaCl, 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 2mM 2F3 U-13C,15N, 20mM NaPi pH 7.0, 20mM NaCl, 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 2mM 2F3 U-13C,15N, 20mM NaPi pH 7.0, 20mM NaCl, 100% D2O \| 100% D2O NMR sample composition 1mM 2F3 U-15N, 20mM NaPi pH 7.0, 20mM NaCl, 4% Radially compressed polyacrylamide gel, 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2HA1 Complex of the first and second type III domains of human Fibronectin in solution Deposited 2006-06-12	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 609–809（201 aa） Fragment：Fibronectin first and second type III domain pair (1F3-2F3)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；303 K；Ionic strength (raw mmCIF value) 150mM NaCl, 20mM Na2HPO3；Pressure ambient NMR sample composition 1.0mM 1F3-2F3 U-15N, 150mM NaCl, 20mM NaPi pH 7.0, 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 1.0mM 1F3-2F3 U-15N, 13C, 150mM NaCl, 20mM NaPi pH 7.0, 95% H2O, 5% D2O \| 95% H2O/5% D2O NMR sample composition 0.6mM 1F3-2F3 U-15N, 150mM NaCl, 20mM NaPi pH 7.0, 4% Radially compressed polyacrylamide gel, 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
2N1K Structure of the Third Type III Domain from Human Fibronectin Deposited 2015-04-04	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 808–905（98 aa） Fragment：third FN3 domain (UNP residues 808-905)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；298.15 K；Ionic strength (raw mmCIF value) 0.17；Pressure ambient NMR sample composition 0.6 mM [U-99% 13C; U-99% 15N] 3FN3, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM [U-99% 15N] 3FN3, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM 3FN3, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM 3FN3, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 100% D2O \| 100% D2O NMR sample composition 0.9 mM [U-99% 13C; U-99% 15N] 3FN3, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 0.9 mM 3FN3, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2OCF Human estrogen receptor alpha ligand-binding domain in complex with estradiol and the E2#23 FN3 monobody Deposited 2006-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1447–1540（94 aa） Fragment：E2#23 FN3 MONOBODY, Fibronectin type III Domain 10, Residues 1447-1540	Mutation：R1452T, D1453K, R1524L, G1525R, D1526L, S1527M, P1528L, S1530G	EST ESTRADIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；289 K；2.5M NaCl, 0.1M Imidazole, pH 8.0, 0.2M Zn(OAc)2, VAPOR DIFFUSION, SITTING DROP, temperature 289K	Resolution 2.95 Å R-free 0.251
2RKY Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-1 Deposited 2007-10-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 183–275（93 aa） Fragment：UNP residues 183-275	Not recorded	SCN THIOCYANATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；100mM Tris-HCl, pH8.5, 0.15M Potassium thiocyanate, 20% PEG400, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.216
2RKY Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-1 Deposited 2007-10-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 183–275（93 aa） Fragment：UNP residues 183-275	Not recorded	SCN THIOCYANATE ION × 3 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；100mM Tris-HCl, pH8.5, 0.15M Potassium thiocyanate, 20% PEG400, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.216
2RKZ Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1 Deposited 2007-10-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 93–182（90 aa） Fragment：UNP residues 93-182	Not recorded	SIN SUCCINIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.8M SUCCINIC ACID, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.261
2RKZ Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1 Deposited 2007-10-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 93–182（90 aa） Fragment：UNP residues 93-182	Not recorded	SIN SUCCINIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.8M SUCCINIC ACID, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.261
2RKZ Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1 Deposited 2007-10-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 93–182（90 aa） Fragment：UNP residues 93-182	Not recorded	SIN SUCCINIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.8M SUCCINIC ACID, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.261
2RKZ Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1 Deposited 2007-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 93–182（90 aa） Fragment：UNP residues 93-182	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.8M SUCCINIC ACID, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.261
2RKZ Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1 Deposited 2007-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 93–182（90 aa） Fragment：UNP residues 93-182	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.8M SUCCINIC ACID, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.261
2RKZ Crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1 Deposited 2007-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 93–182（90 aa） Fragment：UNP residues 93-182	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.8M SUCCINIC ACID, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.261
2RL0 Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5 Deposited 2007-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 184–272（89 aa） Fragment：UNP residues 184-272	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；291 K；0.2M NACL, 0.1M BIS TRIS, 14% PEG3350, pH6.2, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.266
2RL0 Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5 Deposited 2007-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 184–272（89 aa） Fragment：UNP residues 184-272	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；291 K；0.2M NACL, 0.1M BIS TRIS, 14% PEG3350, pH6.2, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.266
2RL0 Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5 Deposited 2007-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 184–272（89 aa） Fragment：UNP residues 184-272	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；291 K；0.2M NACL, 0.1M BIS TRIS, 14% PEG3350, pH6.2, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.266
2RL0 Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5 Deposited 2007-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 184–272（89 aa） Fragment：UNP residues 184-272	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；291 K；0.2M NACL, 0.1M BIS TRIS, 14% PEG3350, pH6.2, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.266
2RL0 Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5 Deposited 2007-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 184–272（89 aa） Fragment：UNP residues 184-272	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；291 K；0.2M NACL, 0.1M BIS TRIS, 14% PEG3350, pH6.2, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.266
2RL0 Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5 Deposited 2007-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 184–272（89 aa） Fragment：UNP residues 184-272	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；291 K；0.2M NACL, 0.1M BIS TRIS, 14% PEG3350, pH6.2, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.00 Å R-free 0.266
3CAL Crystal structure of the second and third fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5 Deposited 2008-02-20	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 93–182（90 aa） Fragment：UNP residues 93-182, Second and third F1 modules	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.95M succinic acid, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.70 Å R-free 0.217
3CAL Crystal structure of the second and third fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5 Deposited 2008-02-20	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 93–182（90 aa） Fragment：UNP residues 93-182, Second and third F1 modules	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.95M succinic acid, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.70 Å R-free 0.217
3CH8 The crystal structure of PDZ-Fibronectin fusion protein Deposited 2008-03-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1538–1631（94 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；31% isopropanol, 0.1M HEPES, 0.2M MgCl2, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.90 Å R-free 0.260
3EJH Crystal Structure of the Fibronectin 8-9FnI Domain Pair in Complex with a Type-I Collagen Peptide Deposited 2008-09-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 516–608（93 aa） Fragment：8-9FnI	Mutation：N528Q, R534K	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；2.5 M NaCl, 0.1 M BisTris pH 6.5 , VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.10 Å R-free 0.242
3EJH Crystal Structure of the Fibronectin 8-9FnI Domain Pair in Complex with a Type-I Collagen Peptide Deposited 2008-09-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 516–608（93 aa） Fragment：8-9FnI	Mutation：N528Q, R534K	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；2.5 M NaCl, 0.1 M BisTris pH 6.5 , VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.10 Å R-free 0.242
3GXE Complex of a Low Affinity Collagen Site with the Fibronectin 8-9FnI Domain Pair Deposited 2009-04-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 516–608（93 aa） Fragment：8-9FnI, UNP residues 516-608	Mutation：N528Q, R534K	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.1 K；0.1M HEPES pH 7.5, 4.3M NaCl, VAPOR DIFFUSION, SITTING DROP, temperature 293.1K	Resolution 2.60 Å R-free 0.271
3GXE Complex of a Low Affinity Collagen Site with the Fibronectin 8-9FnI Domain Pair Deposited 2009-04-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 516–608（93 aa） Fragment：8-9FnI, UNP residues 516-608	Mutation：N528Q, R534K	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.1 K；0.1M HEPES pH 7.5, 4.3M NaCl, VAPOR DIFFUSION, SITTING DROP, temperature 293.1K	Resolution 2.60 Å R-free 0.271
3R8Q Structure of Fibronectin domain 12-14 Deposited 2011-03-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1722–1992（271 aa） Fragment：unp residues 1722-1992	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；0.1 M Na HEPES, 0.8 M sodium dihydrogen phosphate, 0.8 M potassium dihydrogen phosphate, supplemented with 35% glycerol for cryo-protection, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.40 Å R-free 0.236
3ZRZ Crystal structure of the second and third fibronectin F1 modules in complex with a fragment of Streptococcus pyogenes SfbI-5 Deposited 2011-06-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 93–182（90 aa） Fragment：SECOND AND THIRD F1 MODULES, RESIDUES 93-182	Not recorded	SO4 SULFATE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；CRYSTALS OF THE PROTEIN/PEPTIDE COMPLEX (0.3 MM/3.5 MM, PH 7.7) WERE GROWN USING SITTING DROP VAPOUR DIFFUSION FROM A 1:1 DILUTION WITH WELL SOLUTION (0.1 M TRIS PH 7.0, 1.5 M (NH4)2SO4 AT 18 DEGREES CENTIGRADE	Resolution 1.70 Å R-free 0.222
3ZRZ Crystal structure of the second and third fibronectin F1 modules in complex with a fragment of Streptococcus pyogenes SfbI-5 Deposited 2011-06-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 93–182（90 aa） Fragment：SECOND AND THIRD F1 MODULES, RESIDUES 93-182	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；CRYSTALS OF THE PROTEIN/PEPTIDE COMPLEX (0.3 MM/3.5 MM, PH 7.7) WERE GROWN USING SITTING DROP VAPOUR DIFFUSION FROM A 1:1 DILUTION WITH WELL SOLUTION (0.1 M TRIS PH 7.0, 1.5 M (NH4)2SO4 AT 18 DEGREES CENTIGRADE	Resolution 1.70 Å R-free 0.222
4GH7 Crystal structure of Anticalin N7A in complex with oncofetal fibronectin fragment Fn7B8 Deposited 2012-08-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1173–1448（276 aa） Fragment：Fn7B8, UNP residues 1173-1448	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；17-19%(w/v) PEG3350, 0.1M Na-citrate, pH 5.5-6.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.60 Å R-free 0.259
4GH7 Crystal structure of Anticalin N7A in complex with oncofetal fibronectin fragment Fn7B8 Deposited 2012-08-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1173–1448（276 aa） Fragment：Fn7B8, UNP residues 1173-1448	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；17-19%(w/v) PEG3350, 0.1M Na-citrate, pH 5.5-6.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.60 Å R-free 0.259
4LXO Crystal structure of 9,10Fn3-elegantin chimera Deposited 2013-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1357–1540（184 aa）	Mutation：L1408P, V1490C, T1491R, G1492A, S1496N, A1498D, S1499C	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.6；293 K；0.2M calcium acetate, 7%(w/v) PEG10000, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.42 Å R-free 0.193
4LXO Crystal structure of 9,10Fn3-elegantin chimera Deposited 2013-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1357–1540（184 aa）	Mutation：L1408P, V1490C, T1491R, G1492A, S1496N, A1498D, S1499C	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.6；293 K；0.2M calcium acetate, 7%(w/v) PEG10000, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.42 Å R-free 0.193
4MMX Integrin AlphaVBeta3 ectodomain bound to the tenth domain of Fibronectin Deposited 2013-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1539–1631（93 aa） Fragment：Fibronectin type-III domain 10 (UNP residues 1448-1540)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 MN MANGANESE (II) ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；277.15 K；12% PEG3350, 0.8 M sodium chloride, 0.1 M sodium acetate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 3.32 Å R-free 0.269
4MMY Integrin AlphaVBeta3 ectodomain bound to the tenth domain of Fibronectin with the IAKGDWND motif Deposited 2013-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1448–1540（93 aa） Fragment：Fibronectin type-III domain 10 (UNP residues 1448-1540)	Mutation：TGRGDSPASS to IARGDWNDG	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 MN MANGANESE (II) ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；277.15 K；12% PEG3350, 0.8 M sodium chloride, 0.1 M sodium acetate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 3.18 Å R-free 0.252
4MMZ Integrin AlphaVBeta3 ectodomain bound to an antagonistic tenth domain of Fibronectin Deposited 2013-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1539–1631（93 aa） Fragment：Fibronectin type-III domain 10 (UNP residues 1448-1540)	Mutation：GRGDSPAS to PRGDWNEG	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 MN MANGANESE (II) ION × 8 NA SODIUM ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；277.15 K；12% PEG3350, 0.8 M sodium chloride, 0.1 M sodium acetate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 3.10 Å R-free 0.255
4PZ5 Crystal structure of the second and third fibronectin F1 modules in complex with a fragment of BBK32 from Borrelia burgdorferi Deposited 2014-03-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 93–182（90 aa） Fragment：2FN1-3FN1, UNP RESIDUES 93-182	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.9；291 K；1.4 M Na/K phosphate, pH 6.9, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.96 Å R-free 0.199
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1539–1635（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 10 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain J 1539–1635（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1539–1635（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1539–1635（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1539–1635（97 aa）	Not recorded	CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1539–1635（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 1539–1635（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 1539–1635（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 1539–1635（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5DFT Structure of the Eleventh Type III Domain from Human Fibronectin Deposited 2015-08-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 9 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 1539–1635（97 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.1M sodium citrate, 0.1M citric acid and 0.1M sodium iodine	Resolution 2.50 Å R-free 0.248
5J6Z Structure of anastellin bound to beta-strands A and B from the third type III domain of fibronectin Deposited 2016-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 806–834（29 aa） Fragment：residues 806-834 Chain B 631–705（75 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；298 K；Ionic strength (raw mmCIF value) 166；Pressure 100000 NMR sample composition 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM [U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM AB, 0.6 mM [U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
5M0A Solution structure of isolated 15th Fibronectin III domain from human fibronectin Deposited 2016-10-04	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2108–2193（86 aa） Fragment：15th Fibronectin III domain, UNP residues 2108-2193	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 161；Pressure 1 NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 161；Pressure 1 NMR sample composition 10 mM TRIS, 150 mM sodium chloride, 0.02 ug/mL TSP, 1 mM sodium azide, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 0.5 mM EDTA, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 10 mM [U-2H] TRIS, 0.35 mM [U-13C; U-15N] 15th Fibronectin III domain from human fibronectin, 150 mM sodium chloride, 1 mM sodium azide, 0.02 ug/mL TSP, 0.5 mM EDTA, 100% D2O \| 100% D2O	Resolution not provided
5N47 Structure of Anticalin N7E in complex with the three-domain fragment Fn7B8 of human oncofetal fibronectin Deposited 2017-02-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1173–1448（276 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；17 % (w/v) PEG3350, 0.2 M NaCl, 0.1 M Na-malonate	Resolution 3.00 Å R-free 0.241
5N47 Structure of Anticalin N7E in complex with the three-domain fragment Fn7B8 of human oncofetal fibronectin Deposited 2017-02-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1173–1448（276 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；17 % (w/v) PEG3350, 0.2 M NaCl, 0.1 M Na-malonate	Resolution 3.00 Å R-free 0.241
5N47 Structure of Anticalin N7E in complex with the three-domain fragment Fn7B8 of human oncofetal fibronectin Deposited 2017-02-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1173–1448（276 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；17 % (w/v) PEG3350, 0.2 M NaCl, 0.1 M Na-malonate	Resolution 3.00 Å R-free 0.241
5N48 Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin Deposited 2017-02-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1266–1357（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；29 % (w/v) PEG4000, 0.1 M Na-malonate	Resolution 1.60 Å R-free 0.208
5N48 Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin Deposited 2017-02-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1266–1357（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；29 % (w/v) PEG4000, 0.1 M Na-malonate	Resolution 1.60 Å R-free 0.208
6HNF Structure in solution of human fibronectin type III-domain 14 Deposited 2018-09-14	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1904–1991（88 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298 K；Ionic strength (raw mmCIF value) 162.7；Pressure 1030 NMR sample composition 1.0 mM [U-13C; U-15N] FNIII14, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6MFA Fragment of human fibronectin containing the 4th-7th type III domains Deposited 2018-09-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 903–1268（366 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；0.1 M MES pH 5.5, 7% PEG 6000	Resolution 1.75 Å R-free 0.238
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 10 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain J 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 11 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 12 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain L 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 13 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1085–1173（89 aa） Chain G 1085–1173（89 aa） Chain H 1085–1173（89 aa） Chain J 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 14 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain B 1085–1173（89 aa） Chain D 1085–1173（89 aa） Chain F 1085–1173（89 aa） Chain L 1085–1173（89 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 15 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 1085–1173（89 aa） Chain E 1085–1173（89 aa） Chain I 1085–1173（89 aa） Chain K 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1085–1173（89 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 1085–1173（89 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6MSV Structure of the 6th type III domain from human fibronectin Deposited 2018-10-18	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 9 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 1085–1173（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.0 M Ammonium Sulfate	Resolution 2.40 Å R-free 0.295
6NAJ Integrin AlphaVBeta3 ectodomain bound to Hr10 variant of the 10th domain of Fibronectin. Deposited 2018-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1539–1629（91 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7 MN MANGANESE (II) ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；277 K；100 M Sodium Acetate, PEG4000, 800 mM Sodium Chloride.	Resolution 3.10 Å R-free 0.268
6XAX Structure of a fragment of human fibronectin containing the 11th type III domain, extra domain A, and the 12th type III domain Deposited 2020-06-04	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1630–1903（274 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2M Ca(CH3COO)2, 0.1M imidazole pH 8.0, 10%(w/v) PEG 8000	Resolution 2.40 Å R-free 0.312
6XAX Structure of a fragment of human fibronectin containing the 11th type III domain, extra domain A, and the 12th type III domain Deposited 2020-06-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1630–1903（274 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2M Ca(CH3COO)2, 0.1M imidazole pH 8.0, 10%(w/v) PEG 8000	Resolution 2.40 Å R-free 0.312
6XAY Structure of a fragment of human fibronectin containing the 10th, 11th and 12th type III domains Deposited 2020-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1447–1722（276 aa）	Mutation：V1643G	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.5M (NH4)2SO4, 0.1M Citric acid pH 4.0, 30%(v/v)PEG 600, 10%(v/v) glycerol	Resolution 2.48 Å R-free 0.296
6XAY Structure of a fragment of human fibronectin containing the 10th, 11th and 12th type III domains Deposited 2020-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1447–1722（276 aa）	Mutation：V1643G	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.5M (NH4)2SO4, 0.1M Citric acid pH 4.0, 30%(v/v)PEG 600, 10%(v/v) glycerol	Resolution 2.48 Å R-free 0.296
6XAY Structure of a fragment of human fibronectin containing the 10th, 11th and 12th type III domains Deposited 2020-06-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1447–1722（276 aa）	Mutation：V1643G	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.5M (NH4)2SO4, 0.1M Citric acid pH 4.0, 30%(v/v)PEG 600, 10%(v/v) glycerol	Resolution 2.48 Å R-free 0.296
6XAY Structure of a fragment of human fibronectin containing the 10th, 11th and 12th type III domains Deposited 2020-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1447–1722（276 aa）	Mutation：V1643G	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.5M (NH4)2SO4, 0.1M Citric acid pH 4.0, 30%(v/v)PEG 600, 10%(v/v) glycerol	Resolution 2.48 Å R-free 0.296
7NWL Cryo-EM structure of human integrin alpha5beta1 (open form) in complex with fibronectin and TS2/16 Fv-clasp Deposited 2021-03-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1173–1540（368 aa）	Not recorded	MN MANGANESE (II) ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
9P6S Cryo-EM structure of human integrin alpha5beta1 in complex with fibronectin (FN 7-10) Deposited 2025-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1449–1631（183 aa）	Not recorded	MN MANGANESE (II) ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.61 Å

54 other PDB entries and 101 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FINC_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–275； UniProt 1174–1447 Author chain B； PDBConstruct 2–275； UniProt 1174–1447 Author chain C； PDBConstruct 2–275； UniProt 1174–1447

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8peq
Deposition date deposition_date	2023-06-14
Structure title title	Complex of diubiquitin-derived artificial binding protein (Affilin) variant Af2 with its target oncofetal fibronectin (fragment 7B8)
Keywords keywords	;extra domain B, EDB, oncofetal fibronectin, ubiquitin, diubiqutin, Affilin, beta strand register shift, strand slippage, scaffold, artificial binding protein, plasticity, directed evolution, DE NOVO PROTEIN ;; DE NOVO PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	39.70 Å
Radius of gyration Rg (electron density) rg_electron	39.13 Å
Forward intensity I(0) i0	303471000.00
Molecular weight molecular_weight	141100.0 kDa
Excluded volume excluded_volume	176610 Å³
Envelope volume envelope_volume	245590 Å³
Hydration-shell volume shell_volume	54130 Å³
Envelope diameter envelope_diameter	139.0 Å
Shell Rg shell_rg	43.20 Å
Envelope Rg envelope_rg	39.09 Å
Shape Rg shape_rg	39.10 Å
Total Rg total_rg	39.47 Å
Total atoms total_atoms	9950
Residues n_residues	1278
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	128.1 Å
Rg (real space) rg_real	39.59 Å
Rg uncertainty (real space) rg_real_error	1.11 Å
I(0) (real space) i0_real	3.0350e+08
I(0) uncertainty (real space) i0_real_error	5.6950e+06
Rg (reciprocal space) rg_reciprocal	39.66 Å
I(0) (reciprocal space) i0_reciprocal	303500000.0000
Solution quality estimate total_estimate	0.8953
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	48.0 Å
Skewness Skewness skewness	0.241
Kurtosis Kurtosis kurtosis	-0.409
Angular range angular_range	— – 0.2000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	19880000.0000
Real-space data points n_real_points	41
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.920; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.876

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Fibronectin
Molecular weight formula_weight	29808.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	10486

MLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSSTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKT

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21

Entity 2 Entity 2 polymer

Description description	Affilin variant Af2
Molecular weight formula_weight	17428.8 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,L,M

MQIFVHTDTGKTITLEVEPSDTIENVKAKIQDKEGIPQDQQRLIWAGKQLEDGRTLSDYNIDPQLKLHLVLRLRAAGGMQIFVTTQTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIWAGKQLEDGRTLSDYNIDYRFLHLVLRLRAA

来源 Source

来源生物 organism	Homo sapiens
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	536

▶

8. Citations (1)

▶

Unit-cell length a length_a	168.650 Å
Unit-cell length b length_b	105.856 Å
Unit-cell length c length_c	78.993 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.53 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.320 Å
Low-resolution limit resolution_low	44.800 Å
R factor r_factor	0.2008
R_work r_work	0.1982
R_free r_free	0.2510

fit	/app/data/saxs_computation/pe/8peq/8peq.fit
pddf	/app/data/pr_computation/pe/8peq/8peq.pr.out
profile	/app/data/saxs_computation/pe/8peq/8peq.dat

Complex of diubiquitin-derived artificial binding protein (Affilin) variant Af2 with its target oncofetal fibronectin (fragment 7B8)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fibronectin

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)