8qek

Neck and tail of phage 812 after tail contraction (composite)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Portal protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 66 DNA 12	Anchor DNA forward strand (120-MER) × 6 Anchor DNA reverse strand (120-MER) × 6 Capsid protein × 12 （A1YTP2） Baseplate hub assembly protein × 6 （A1YTN9） Capsid protein × 6 （A1YTN7） Putative neck protein × 12 （A1YTN6） Major tail sheath protein × 18 （A0A0U1WZ79） ZINC ION × 18	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WIV9_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain D； PDBConstruct 1–563； UniProt 1–563 Author chain p； PDBConstruct 1–563； UniProt 1–563

Capsid protein

OrganismNot specified

UniProt A1YTP2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 66 DNA 12	Portal protein × 12 （A0A0U1WIV9） Anchor DNA forward strand (120-MER) × 6 Anchor DNA reverse strand (120-MER) × 6 Baseplate hub assembly protein × 6 （A1YTN9） Capsid protein × 6 （A1YTN7） Putative neck protein × 12 （A1YTN6） Major tail sheath protein × 18 （A0A0U1WZ79） ZINC ION × 18	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTP2_9CAUD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–142； UniProt 1–142 Author chain G； PDBConstruct 1–142； UniProt 1–142

Baseplate hub assembly protein

OrganismNot specified

UniProt A1YTN9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 66 DNA 12	Portal protein × 12 （A0A0U1WIV9） Anchor DNA forward strand (120-MER) × 6 Anchor DNA reverse strand (120-MER) × 6 Capsid protein × 12 （A1YTP2） Capsid protein × 6 （A1YTN7） Putative neck protein × 12 （A1YTN6） Major tail sheath protein × 18 （A0A0U1WZ79） ZINC ION × 18	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTN9_9CAUD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain M； PDBConstruct 1–278； UniProt 1–278

Capsid protein

OrganismNot specified

UniProt A1YTN7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 66 DNA 12	Portal protein × 12 （A0A0U1WIV9） Anchor DNA forward strand (120-MER) × 6 Anchor DNA reverse strand (120-MER) × 6 Capsid protein × 12 （A1YTP2） Baseplate hub assembly protein × 6 （A1YTN9） Putative neck protein × 12 （A1YTN6） Major tail sheath protein × 18 （A0A0U1WZ79） ZINC ION × 18	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTN7_9CAUD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain S； PDBConstruct 1–292； UniProt 1–292

Putative neck protein

OrganismNot specified

UniProt A1YTN6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 66 DNA 12	Portal protein × 12 （A0A0U1WIV9） Anchor DNA forward strand (120-MER) × 6 Anchor DNA reverse strand (120-MER) × 6 Capsid protein × 12 （A1YTP2） Baseplate hub assembly protein × 6 （A1YTN9） Capsid protein × 6 （A1YTN7） Major tail sheath protein × 18 （A0A0U1WZ79） ZINC ION × 18	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTN6_9CAUD
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain b； PDBConstruct 1–302； UniProt 1–302 Author chain c； PDBConstruct 1–302； UniProt 1–302

Major tail sheath protein

OrganismNot specified

UniProt A0A0U1WZ79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 66 DNA 12	Portal protein × 12 （A0A0U1WIV9） Anchor DNA forward strand (120-MER) × 6 Anchor DNA reverse strand (120-MER) × 6 Capsid protein × 12 （A1YTP2） Baseplate hub assembly protein × 6 （A1YTN9） Capsid protein × 6 （A1YTN7） Putative neck protein × 12 （A1YTN6） ZINC ION × 18	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WZ79_9CAUD
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B； PDBConstruct 1–587； UniProt 1–587 Author chain I； PDBConstruct 1–587； UniProt 1–587 Author chain O； PDBConstruct 1–587； UniProt 1–587

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8qek
Deposition date deposition_date	2023-08-31
Structure title title	Neck and tail of phage 812 after tail contraction (composite)
Keywords keywords	phage, neck, tail, connector, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8qek__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8qek__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8qek__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	135.90 Å
Total Rg	136.40 Å
Atom count	194880
Residues	22230
Excluded volume	3371400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8qek__assembly_1__model_1`	78-meric （78）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Portal protein
Molecular weight formula_weight	64155.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p,D
Atom count atom_count	32480

MADLFKQFRLGKDYGNNSTIAQVPIDEGLQANIKKIEQDNKEYQDLTKSLYGQQQAYAEPFIEMMDTNPEFRDKRSYMKNEHNLHDVLKKFGNNPILNAIILTRSNQVAMYCQPARYSEKGLGFEVRLRDLDAEPGRKEKEEMKRIEDFIVNTGKDKDVDRDSFQTFCKKIVRDTYIYDQVNFEKVFNKNNKTKLEKFIAVDPSTIFYATDKKGKIIKGGKRFVQVVDKRVVASFTSRELAMGIRNPRTELSSSGYGLSEVEIAMKEFIAYNNTESFNDRFFSHGGTTRGILQIRSDQQQSQHALENFKREWKSSLSGINGSWQIPVVMADDIKFVNMTPTANDMQFEKWLNYLINIISALYGIDPAEIGFPNRGGATGSKGGSTLNEADPGKKQQQSQNKGLQPLLRFIEDLVNRHIISEYGDKYTFQFVGGDTKSATDKLNILKLETQIFKTVNEAREEQGKKPIEGGDIILDASFLQGTAQLQQDKQYNDGKQKERLQMMMSLLEGDNDDSEEGQSTDSSNDDKEIGTDAQIKGDDNVYRTQTSNKGQGRKGEKSSDFKH

Entity 2 Entity 2 polymer

Description description	Anchor DNA forward strand (120-MER)
Molecular weight formula_weight	36242.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

TACACTTATCTACACTTATCTACACTTATCTACACTTATCTACACTTATCTACACTTATCTACACTTATCTACACTTATCTACACTTATCTACACTTATCTACACTTATCTACACTTATC

Entity 3 Entity 3 polymer

Description description	Anchor DNA reverse strand (120-MER)
Molecular weight formula_weight	37791.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Z

GATAAGTGTAGATAAGTGTAGATAAGTGTAGATAAGTGTAGATAAGTGTAGATAAGTGTAGATAAGTGTAGATAAGTGTAGATAAGTGTAGATAAGTGTAGATAAGTGTAGATAAGTGTA

Entity 4 Entity 4 polymer

Description description	Capsid protein
Molecular weight formula_weight	15943.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,G

MASEAKQTVHTGNTVLLMIKGKPVGRAQSASGQREYGTTGVYEIGSIMPQEHVYLRYEGTITVERLRMKKENFADLGYASLGEEILKKDIIDILVVDNLTKQVIISYHGCSANNYNETWQTNEIVTEEIEFSYLTASDKART

Entity 5 Entity 5 polymer

Description description	Baseplate hub assembly protein
Molecular weight formula_weight	31799.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MAITSVDSYLLSEIKPRLNTVLENCYIIDEVLKDFDYQTRESFKEAFCGKNAQHEVTVGFNFPKFKNNYEAHYLIQLGQGQETKNSLGSIQSSYFEATGDTLVESSTAIREDDKLVFTVSKPIGELIKVEDIEFAKYDNLQVEGNKVSFKYQTNEDYENYNANIIFTEKKNDSKGLVKGFTVEEQVTVVGLSFNVDVARCLDAVLKMILISMRDSIEEQQTFQLQNLSFGDIAPIIEDGDSMIFGRPTIIKYTSSLDLDYTITQDINKLTFKERKDWK

Entity 6 Entity 6 polymer

Description description	Capsid protein
Molecular weight formula_weight	33757.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MEKPYMIGANSNPNVINKSTTYTTTTQADEQDKPKYTTRLEFDTIDMIRFINDRGIKVLWEEAYFCPCLNPDTGHPRVDCPRCHGKGIAYLPPKETIMAIQSQEKGTNQLDIGILDTGTAIGTTQLEKRISYRDRFTVPEVLMPQQMIYFVNKDRIKKGIPLYYDVKEITYIATQDGTVYEEDYEIKNNRLYLNEKYENHTVTLKILMTLRYVVSDILKESRYQYTKFNQPKSKFENLPQKLLLKREDVIVLQDPYKVNDGIEEDLEIQVDDPKASASNPSNLGGFFGGAFK

Entity 7 Entity 7 polymer

Description description	Putative neck protein
Molecular weight formula_weight	34191.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,c

MVNSMFGGDLDPYEKSLNYEYPYHPSGNPKHIDVSEIDNLTLADYGWSPDAVKAYMFGIVVQNPDTGQPMGDEFYNHILERAVGKAERALDISILPDTQHEMRDYHETEFNSYMFVHAYRKPILQVENLQLQFNGRPIYKYPANWWKVEHLAGHVQLFPTALMQTGQSMSYDAVFNGYPQLAGVYPPSGATFAPQMIRLEYVSGMLPRKKAGRNKPWEMPPELEQLVIKYALKEIYQVWGNLIIGAGIANKTLEVDGITETIGTTQSAMYGGASAQILQINEDIKELLDGLRAYFGYNMIGL

Entity 8 Entity 8 polymer

Description description	Major tail sheath protein
Molecular weight formula_weight	64559.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,I,O

MAVEPFPRRPITRPHASIEVDTSGIGGSAGSSEKVFCLIGQAEGGEPNTVYELRNYSQAKRLFRSGELLDAIELAWGSNPNYTAGRILAMRIEDAKPASAEIGGLKITSKIYGNVANNIQVGLEKNTLSDSLRLRVIFQDDRFNEVYDNIGNIFTIKYKGEEANATFSVEHDEETQKASRLVLKVGDQEVKSYDLTGGAYDYTNAIITDINQLPDFEAKLSPFGDKNLESSKLDKIENANIKDKAVYVKAVFGDLEKQTAYNGIVSFEQLNAEGEVPSNVEVEAGEESATVTATSPIKTIEPFELTKLKGGTNGEPPATWADKLDKFAHEGGYYIVPLSSKQSVHAEVASFVKERSDAGEPMRAIVGGGFNESKEQLFGRQASLSNPRVSLVANSGTFVMDDGRKNHVPAYMVAVALGGLASGLEIGESITFKPLRVSSLDQIYESIDLDELNENGIISIEFVRNRTNTFFRIVDDVTTFNDKSDPVKAEMAVGEANDFLVSELKVQLEDQFIGTRTINTSASIIKDFIQSYLGRKKRDNEIQDFPAEDVQVIVEGNEARISMTVYPIRSFKKISVSLVYKQQTLQA

Entity 9 Entity 9 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	17304

Neck and tail of phage 812 after tail contraction (composite)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Portal protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate hub assembly protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative neck protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Major tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8qek__assembly_1__model_1

8qek__assembly_1__model_1 | I(q)

8qek__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 non-polymer

7. Citations (1)