SAXSdb — 8qpc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding protein 7b

Sulfolobus acidocaldarius

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	N-[2-(2-methyl-1,3-dioxolan-2-yl)phenyl]-2-{[5-(trifluoromethyl)pyridin-2-yl]amino}pyridine-4-carboxamide × 1 N-[2-(2-methyl-1,3-dioxolan-2-yl)phenyl]-2-{[5-(trifluoromethyl)pyridin-2-yl]amino}pyridine-4-carboxamide × 1	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DN7D_SULAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AA； PDBConstruct 1–66； UniProt 1–66

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8qpc
Deposition date deposition_date	2023-10-01
Structure title title	18mer DNA mimic Foldamer with an Aromatic linker in complex with Sac7d V26A/M29A protein
Keywords keywords	Foldamer, DNA mimic foldamer, DNA mimicry, Sac7d, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8qpc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8qpc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8qpc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.32 Å
Rg (electron density)	14.34 Å
Total Rg	15.40 Å
Atom count	812
Residues	63
Excluded volume	13673 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8qpc__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	DNA-binding protein 7b
Molecular weight formula_weight	7538.7 kDa
Mutation mutation	V26A/M29A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA
Atom count atom_count	812

MVKVKFKYKGEEKEVDTSKIKKVWRAGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK

Source Source

Source organism organism	Sulfolobus acidocaldarius
NCBI taxonomy ID ncbi_taxonomy_id	2285
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	N-[2-(2-methyl-1,3-dioxolan-2-yl)phenyl]-2-{[5-(trifluoromethyl)pyridin-2-yl]amino}pyridine-4-carboxamide
Molecular weight formula_weight	2561.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TXXXXXXXXX

Entity 3 Entity 3 polymer

Description description	N-[2-(2-methyl-1,3-dioxolan-2-yl)phenyl]-2-{[5-(trifluoromethyl)pyridin-2-yl]amino}pyridine-4-carboxamide
Molecular weight formula_weight	2563.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

XXXXXXXXXX

▶

Unit-cell length a length_a	70.907 Å
Unit-cell length b length_b	70.907 Å
Unit-cell length c length_c	121.997 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 64 2 2
Space-group number int_tables_number	181
Crystal system crystal_system	hexagonal

Resolution resolution	3.240 Å
Low-resolution limit resolution_low	61.410 Å
R factor r_factor	0.3362
R_work r_work	0.3356
R_free r_free	0.3481

18mer DNA mimic Foldamer with an Aromatic linker in complex with Sac7d V26A/M29A protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding protein 7b

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8qpc__assembly_1__model_1

8qpc__assembly_1__model_1 | I(q)

8qpc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (3)

18mer DNA mimic Foldamer with an Aromatic linker in complex with Sac7d V26A/M29A protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding protein 7b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8qpc__assembly_1__model_1

8qpc__assembly_1__model_1 | I(q)

8qpc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (3)