8r69

Neck and tail of phage 812 virion (composite)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Major tail sheath protein × 12 （A0A0U1WZ79） Portal protein × 12 （A0A0U1WIV9） Capsid protein × 6 （A1YTN7） Baseplate hub assembly protein × 6 （A1YTN9） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Non-cytoplasmic protein × 12 （A0A0U1WIM1） Putative neck protein × 12 （A1YTN6） ZINC ION × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTP2_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain T； PDBConstruct 1–142； UniProt 1–142 Author chain U； PDBConstruct 1–142； UniProt 1–142

Major tail sheath protein

OrganismNot specified

UniProt A0A0U1WZ79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Capsid protein × 12 （A1YTP2） Portal protein × 12 （A0A0U1WIV9） Capsid protein × 6 （A1YTN7） Baseplate hub assembly protein × 6 （A1YTN9） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Non-cytoplasmic protein × 12 （A0A0U1WIM1） Putative neck protein × 12 （A1YTN6） ZINC ION × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WZ79_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain V； PDBConstruct 1–587； UniProt 1–587 Author chain W； PDBConstruct 1–587； UniProt 1–587

Portal protein

OrganismNot specified

UniProt A0A0U1WIV9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Capsid protein × 12 （A1YTP2） Major tail sheath protein × 12 （A0A0U1WZ79） Capsid protein × 6 （A1YTN7） Baseplate hub assembly protein × 6 （A1YTN9） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Non-cytoplasmic protein × 12 （A0A0U1WIM1） Putative neck protein × 12 （A1YTN6） ZINC ION × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WIV9_9CAUD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–563； UniProt 1–563 Author chain B； PDBConstruct 1–563； UniProt 1–563

Capsid protein

OrganismNot specified

UniProt A1YTN7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Capsid protein × 12 （A1YTP2） Major tail sheath protein × 12 （A0A0U1WZ79） Portal protein × 12 （A0A0U1WIV9） Baseplate hub assembly protein × 6 （A1YTN9） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Non-cytoplasmic protein × 12 （A0A0U1WIM1） Putative neck protein × 12 （A1YTN6） ZINC ION × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTN7_9CAUD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–292； UniProt 1–292

Baseplate hub assembly protein

OrganismNot specified

UniProt A1YTN9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Capsid protein × 12 （A1YTP2） Major tail sheath protein × 12 （A0A0U1WZ79） Portal protein × 12 （A0A0U1WIV9） Capsid protein × 6 （A1YTN7） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Non-cytoplasmic protein × 12 （A0A0U1WIM1） Putative neck protein × 12 （A1YTN6） ZINC ION × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTN9_9CAUD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–278； UniProt 1–278

Putative non-cytoplasmic protein

OrganismNot specified

UniProt A0A0U1WZ69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Capsid protein × 12 （A1YTP2） Major tail sheath protein × 12 （A0A0U1WZ79） Portal protein × 12 （A0A0U1WIV9） Capsid protein × 6 （A1YTN7） Baseplate hub assembly protein × 6 （A1YTN9） Non-cytoplasmic protein × 12 （A0A0U1WIM1） Putative neck protein × 12 （A1YTN6） ZINC ION × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WZ69_9CAUD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain N； PDBConstruct 1–87； UniProt 1–87 Author chain n； PDBConstruct 1–87； UniProt 1–87

Non-cytoplasmic protein

OrganismNot specified

UniProt A0A0U1WIM1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Capsid protein × 12 （A1YTP2） Major tail sheath protein × 12 （A0A0U1WZ79） Portal protein × 12 （A0A0U1WIV9） Capsid protein × 6 （A1YTN7） Baseplate hub assembly protein × 6 （A1YTN9） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Putative neck protein × 12 （A1YTN6） ZINC ION × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WIM1_9CAUD
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain S； PDBConstruct 1–152； UniProt 1–152 Author chain s； PDBConstruct 1–152； UniProt 1–152

Putative neck protein

OrganismNot specified

UniProt A1YTN6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Capsid protein × 12 （A1YTP2） Major tail sheath protein × 12 （A0A0U1WZ79） Portal protein × 12 （A0A0U1WIV9） Capsid protein × 6 （A1YTN7） Baseplate hub assembly protein × 6 （A1YTN9） Putative non-cytoplasmic protein × 12 （A0A0U1WZ69） Non-cytoplasmic protein × 12 （A0A0U1WIM1） ZINC ION × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A1YTN6_9CAUD
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain C； PDBConstruct 1–302； UniProt 1–302 Author chain D； PDBConstruct 1–302； UniProt 1–302

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8r69
Deposition date deposition_date	2023-11-21
Structure title title	Neck and tail of phage 812 virion (composite)
Keywords keywords	phage, neck, connector, tail, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8r69__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8r69__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8r69__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	115.80 Å
Total Rg	115.70 Å
Atom count	182664
Residues	22830
Excluded volume	3249300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8r69__assembly_1__model_1`	84-meric （84）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Capsid protein
Molecular weight formula_weight	15943.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,U
Atom count atom_count	30444

MASEAKQTVHTGNTVLLMIKGKPVGRAQSASGQREYGTTGVYEIGSIMPQEHVYLRYEGTITVERLRMKKENFADLGYASLGEEILKKDIIDILVVDNLTKQVIISYHGCSANNYNETWQTNEIVTEEIEFSYLTASDKART

Entity 2 Entity 2 polymer

Description description	Major tail sheath protein
Molecular weight formula_weight	64559.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,W

MAVEPFPRRPITRPHASIEVDTSGIGGSAGSSEKVFCLIGQAEGGEPNTVYELRNYSQAKRLFRSGELLDAIELAWGSNPNYTAGRILAMRIEDAKPASAEIGGLKITSKIYGNVANNIQVGLEKNTLSDSLRLRVIFQDDRFNEVYDNIGNIFTIKYKGEEANATFSVEHDEETQKASRLVLKVGDQEVKSYDLTGGAYDYTNAIITDINQLPDFEAKLSPFGDKNLESSKLDKIENANIKDKAVYVKAVFGDLEKQTAYNGIVSFEQLNAEGEVPSNVEVEAGEESATVTATSPIKTIEPFELTKLKGGTNGEPPATWADKLDKFAHEGGYYIVPLSSKQSVHAEVASFVKERSDAGEPMRAIVGGGFNESKEQLFGRQASLSNPRVSLVANSGTFVMDDGRKNHVPAYMVAVALGGLASGLEIGESITFKPLRVSSLDQIYESIDLDELNENGIISIEFVRNRTNTFFRIVDDVTTFNDKSDPVKAEMAVGEANDFLVSELKVQLEDQFIGTRTINTSASIIKDFIQSYLGRKKRDNEIQDFPAEDVQVIVEGNEARISMTVYPIRSFKKISVSLVYKQQTLQA

Entity 3 Entity 3 polymer

Description description	Portal protein
Molecular weight formula_weight	64155.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MADLFKQFRLGKDYGNNSTIAQVPIDEGLQANIKKIEQDNKEYQDLTKSLYGQQQAYAEPFIEMMDTNPEFRDKRSYMKNEHNLHDVLKKFGNNPILNAIILTRSNQVAMYCQPARYSEKGLGFEVRLRDLDAEPGRKEKEEMKRIEDFIVNTGKDKDVDRDSFQTFCKKIVRDTYIYDQVNFEKVFNKNNKTKLEKFIAVDPSTIFYATDKKGKIIKGGKRFVQVVDKRVVASFTSRELAMGIRNPRTELSSSGYGLSEVEIAMKEFIAYNNTESFNDRFFSHGGTTRGILQIRSDQQQSQHALENFKREWKSSLSGINGSWQIPVVMADDIKFVNMTPTANDMQFEKWLNYLINIISALYGIDPAEIGFPNRGGATGSKGGSTLNEADPGKKQQQSQNKGLQPLLRFIEDLVNRHIISEYGDKYTFQFVGGDTKSATDKLNILKLETQIFKTVNEAREEQGKKPIEGGDIILDASFLQGTAQLQQDKQYNDGKQKERLQMMMSLLEGDNDDSEEGQSTDSSNDDKEIGTDAQIKGDDNVYRTQTSNKGQGRKGEKSSDFKH

Entity 4 Entity 4 polymer

Description description	Capsid protein
Molecular weight formula_weight	33757.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MEKPYMIGANSNPNVINKSTTYTTTTQADEQDKPKYTTRLEFDTIDMIRFINDRGIKVLWEEAYFCPCLNPDTGHPRVDCPRCHGKGIAYLPPKETIMAIQSQEKGTNQLDIGILDTGTAIGTTQLEKRISYRDRFTVPEVLMPQQMIYFVNKDRIKKGIPLYYDVKEITYIATQDGTVYEEDYEIKNNRLYLNEKYENHTVTLKILMTLRYVVSDILKESRYQYTKFNQPKSKFENLPQKLLLKREDVIVLQDPYKVNDGIEEDLEIQVDDPKASASNPSNLGGFFGGAFK

Entity 5 Entity 5 polymer

Description description	Baseplate hub assembly protein
Molecular weight formula_weight	31799.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAITSVDSYLLSEIKPRLNTVLENCYIIDEVLKDFDYQTRESFKEAFCGKNAQHEVTVGFNFPKFKNNYEAHYLIQLGQGQETKNSLGSIQSSYFEATGDTLVESSTAIREDDKLVFTVSKPIGELIKVEDIEFAKYDNLQVEGNKVSFKYQTNEDYENYNANIIFTEKKNDSKGLVKGFTVEEQVTVVGLSFNVDVARCLDAVLKMILISMRDSIEEQQTFQLQNLSFGDIAPIIEDGDSMIFGRPTIIKYTSSLDLDYTITQDINKLTFKERKDWK

Entity 6 Entity 6 polymer

Description description	Putative non-cytoplasmic protein
Molecular weight formula_weight	10146.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,n

MSIEKKEEVIAHNEVVFRSLTQGLYVKEVDIYSDVVSYTKDVDEALAMPNTINFKNSRKYKKLIMNLDLEPLNKIQKVIYETHLEGL

Entity 7 Entity 7 polymer

Description description	Non-cytoplasmic protein
Molecular weight formula_weight	17885.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,s

MADEISLNPIQDAKPIDDIVDIMTYLKNGKVLRVKQDNQGDILVRMSPGKHKFTEVSRDLDKESFYYKRHWVLYNVSVNSLITFDVYLDEEYSETTKVKYPKDTIVEYTREDQEKDVAMIKEILTDNNGNYFYALIGETMLFDENKLNKVKD

Entity 8 Entity 8 polymer

Description description	Putative neck protein
Molecular weight formula_weight	34191.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MVNSMFGGDLDPYEKSLNYEYPYHPSGNPKHIDVSEIDNLTLADYGWSPDAVKAYMFGIVVQNPDTGQPMGDEFYNHILERAVGKAERALDISILPDTQHEMRDYHETEFNSYMFVHAYRKPILQVENLQLQFNGRPIYKYPANWWKVEHLAGHVQLFPTALMQTGQSMSYDAVFNGYPQLAGVYPPSGATFAPQMIRLEYVSGMLPRKKAGRNKPWEMPPELEQLVIKYALKEIYQVWGNLIIGAGIANKTLEVDGITETIGTTQSAMYGGASAQILQINEDIKELLDGLRAYFGYNMIGL

Entity 9 Entity 9 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Resolution resolution	4.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	21731

Neck and tail of phage 812 virion (composite)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Major tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Portal protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate hub assembly protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative non-cytoplasmic protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Non-cytoplasmic protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative neck protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8r69__assembly_1__model_1

8r69__assembly_1__model_1 | I(q)

8r69__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer