SAXSdb — 8t35

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor protein p53-inducible nuclear protein 2,Microtubule-associated proteins 1A/1B light chain 3A

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	1,2-ETHANEDIOL × 8 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T53I2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–12； UniProt 30–39 Author chain B； PDBConstruct 3–12； UniProt 30–39

Tumor protein p53-inducible nuclear protein 2,Microtubule-associated proteins 1A/1B light chain 3A

Homo sapiens

UniProt Q9H492

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	1,2-ETHANEDIOL × 8 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MLP3A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–133； UniProt 1–121 Author chain B； PDBConstruct 13–133； UniProt 1–121

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8t35
Deposition date deposition_date	2023-06-07
Structure title title	Crystal structure of K51 acetylated LC3A in complex with the LIR of TP53INP2/DOR
Keywords keywords	Autophagy, LC3A acetylation, DOR LIR, TP53IP2 LIR, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8t35__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8t35__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8t35__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.55 Å
Rg (electron density)	22.74 Å
Total Rg	23.42 Å
Atom count	4276
Residues	250
Excluded volume	38094 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8t35__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Tumor protein p53-inducible nuclear protein 2,Microtubule-associated proteins 1A/1B light chain 3A
Molecular weight formula_weight	15634.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4313

GSDEVDGWLIIDMPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	37

▶

Unit-cell length a length_a	37.356 Å
Unit-cell length b length_b	49.927 Å
Unit-cell length c length_c	69.784 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	94.61 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.902 Å
Low-resolution limit resolution_low	37.235 Å
R factor r_factor	0.2292
R_work r_work	0.2277
R_free r_free	0.2588

Crystal structure of K51 acetylated LC3A in complex with the LIR of TP53INP2/DOR

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor protein p53-inducible nuclear protein 2,Microtubule-associated proteins 1A/1B light chain 3A

State in the Current Structure

Other States of the Same Protein in the Database

Tumor protein p53-inducible nuclear protein 2,Microtubule-associated proteins 1A/1B light chain 3A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8t35__assembly_1__model_1

8t35__assembly_1__model_1 | I(q)

8t35__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of K51 acetylated LC3A in complex with the LIR of TP53INP2/DOR

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor protein p53-inducible nuclear protein 2,Microtubule-associated proteins 1A/1B light chain 3A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tumor protein p53-inducible nuclear protein 2,Microtubule-associated proteins 1A/1B light chain 3A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8t35__assembly_1__model_1

8t35__assembly_1__model_1 | I(q)

8t35__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)